PCCB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85886

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PCCB Antibody - BSA Free

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining in human liver and skin tissues. Corresponding PCCB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney, liver, salivary gland and tonsil using Anti-PCCB antibody NBP1-85886 (A) shows similar protein distribution across tissues to independent antibody NBP1-85887 (B).
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney using Anti-PCCB antibody NBP1-85886.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human skin shows only weak cytoplasmic positivity in a subset of epidermal cells.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human salivary gland.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human tonsil.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human liver using Anti-PCCB antibody NBP1-85886.
Simple Western: PCCB Antibody [NBP1-85886]

Simple Western: PCCB Antibody [NBP1-85886]

Simple Western: PCCB Antibody [NBP1-85886] - Simple Western lane view shows a specific band for PCCB in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: PCCB Antibody [NBP1-85886]

Simple Western: PCCB Antibody [NBP1-85886]

Simple Western: PCCB Antibody [NBP1-85886] - Electropherogram image(s) of corresponding Simple Western lane view. PCCB antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).
PCCB Antibody - BSA Free Immunohistochemistry-Paraffin: PCCB Antibody - BSA Free [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody - BSA Free [NBP1-85886]

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
PCCB Antibody - BSA Free Immunohistochemistry-Paraffin: PCCB Antibody - BSA Free [NBP1-85886]

Immunohistochemistry-Paraffin: PCCB Antibody - BSA Free [NBP1-85886]

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
PCCB Antibody - BSA Free Western Blot: PCCB Antibody - BSA Free [NBP1-85886]

Western Blot: PCCB Antibody - BSA Free [NBP1-85886]

Analysis using Anti-PCCB antibody NBP1-85886 (A) shows similar pattern to independent antibody NBP1-85887 (B).
PCCB Antibody - BSA Free Western Blot: PCCB Antibody - BSA Free [NBP1-85886]

Western Blot: PCCB Antibody - BSA Free [NBP1-85886]

Analysis in human cell line HepG2.
PCCB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PCCB Antibody - BSA Free [NBP1-85886] -

Dual mRNAs encode functional PCC with proper mitochondrial localization in patient-derived fibroblasts and human Hep3B cells.a–c Comparison of co-transfection of hPCCA+hPCCB (dual) mRNAs with single transfection of hPCCA or hPCCB mRNA alone. Human fibroblasts isolated from a PCCA-deficient PA patient and a PCCB-deficient PA patient (n = 2 per condition) were transfected with 0.5 or 1 ug of the total dual mRNAs (1:1 molar ratio), hPCCA mRNA alone, or hPCCB mRNA alone, or 1 μg of eGFP control mRNA for 24 h. Cells were lysed, and mitochondrial matrix fractions were collected to assess PCC enzymatic activity by a radiometric assay (a), and protein levels of PCCA (b) and PCCB (c) by capillary electrophoresis. d Identification of the optimal molar ratio of hPCCA mRNA:hPCCB mRNA. Patient fibroblasts were transfected with 0.67 nM (1 ug) of total dual mRNAs across a range of molar ratios of hPCCA mRNA:hPCCB mRNA or with the same molar concentration of eGFP mRNA (n = 4 per condition) for 24 h. PCC activity in the cellular mitochondrial matrix fractions was measured. Data are shown as mean +/- SEM. e, f Subcellular localization of dual mRNAs-encoded PCC subunits in PCCA-deficient patient fibroblasts and human liver-derived Hep3B cells. Cells were transfected with 25 ng of dual mRNAs or luciferase (Luc) control mRNA for 24 h, and were stained for PCCA, PCCB, and TOM20, a mitochondrial marker. Scale bars are 20 um. Representative images are shown from n = 24 replicates. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33087718), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PCCB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 58 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCCB

PCCB is encoded by this gene is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. This gene encodes the beta subunit of PCC. Defects in this gene are a cause of propionic acidemia type II (PA-2). [provided by RefSeq]

Alternate Names

beta polypeptide, mitochondrial, propionyl CoA carboxylase, beta polypeptide

Entrez Gene IDs

5096 (Human)

Gene Symbol

PCCB

UniProt

Additional PCCB Products

Product Documents for PCCB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCCB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PCCB Antibody - BSA Free

Customer Reviews for PCCB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCCB Antibody - BSA Free and earn rewards!

Have you used PCCB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...