PCCB Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85886
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for PCCB Antibody - BSA Free
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney, liver, salivary gland and tonsil using Anti-PCCB antibody NBP1-85886 (A) shows similar protein distribution across tissues to independent antibody NBP1-85887 (B).Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney using Anti-PCCB antibody NBP1-85886.Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human skin shows only weak cytoplasmic positivity in a subset of epidermal cells.Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human salivary gland.Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human tonsil.Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886]
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human liver using Anti-PCCB antibody NBP1-85886.Simple Western: PCCB Antibody [NBP1-85886]
Simple Western: PCCB Antibody [NBP1-85886] - Simple Western lane view shows a specific band for PCCB in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: PCCB Antibody [NBP1-85886]
Simple Western: PCCB Antibody [NBP1-85886] - Electropherogram image(s) of corresponding Simple Western lane view. PCCB antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).Immunohistochemistry-Paraffin: PCCB Antibody - BSA Free [NBP1-85886]
Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: PCCB Antibody - BSA Free [NBP1-85886]
Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.Western Blot: PCCB Antibody - BSA Free [NBP1-85886]
Analysis in human cell line HepG2.Immunocytochemistry/ Immunofluorescence: PCCB Antibody - BSA Free [NBP1-85886] -
Dual mRNAs encode functional PCC with proper mitochondrial localization in patient-derived fibroblasts and human Hep3B cells.a–c Comparison of co-transfection of hPCCA+hPCCB (dual) mRNAs with single transfection of hPCCA or hPCCB mRNA alone. Human fibroblasts isolated from a PCCA-deficient PA patient and a PCCB-deficient PA patient (n = 2 per condition) were transfected with 0.5 or 1 ug of the total dual mRNAs (1:1 molar ratio), hPCCA mRNA alone, or hPCCB mRNA alone, or 1 μg of eGFP control mRNA for 24 h. Cells were lysed, and mitochondrial matrix fractions were collected to assess PCC enzymatic activity by a radiometric assay (a), and protein levels of PCCA (b) and PCCB (c) by capillary electrophoresis. d Identification of the optimal molar ratio of hPCCA mRNA:hPCCB mRNA. Patient fibroblasts were transfected with 0.67 nM (1 ug) of total dual mRNAs across a range of molar ratios of hPCCA mRNA:hPCCB mRNA or with the same molar concentration of eGFP mRNA (n = 4 per condition) for 24 h. PCC activity in the cellular mitochondrial matrix fractions was measured. Data are shown as mean +/- SEM. e, f Subcellular localization of dual mRNAs-encoded PCC subunits in PCCA-deficient patient fibroblasts and human liver-derived Hep3B cells. Cells were transfected with 25 ng of dual mRNAs or luciferase (Luc) control mRNA for 24 h, and were stained for PCCA, PCCB, and TOM20, a mitochondrial marker. Scale bars are 20 um. Representative images are shown from n = 24 replicates. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33087718), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for PCCB Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Simple Western
1:20
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 58 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 58 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PCCB
Alternate Names
beta polypeptide, mitochondrial, propionyl CoA carboxylase, beta polypeptide
Entrez Gene IDs
5096 (Human)
Gene Symbol
PCCB
UniProt
Additional PCCB Products
Product Documents for PCCB Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PCCB Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for PCCB Antibody - BSA Free
Customer Reviews for PCCB Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PCCB Antibody - BSA Free and earn rewards!
Have you used PCCB Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...