PDGF-B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58279

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Immunohistochemistry, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PDGF-B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PDGFB(platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)) The peptide sequence was selected from the N terminal of PDGFB. Peptide sequence NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: B.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PDGF-B Antibody - BSA Free

Western Blot: PDGF-B Antibody [NBP1-58279]

Western Blot: PDGF-B Antibody [NBP1-58279]

Western Blot: PDGF-B Antibody [NBP1-58279] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry: PDGF-B Antibody [NBP1-58279]

Immunohistochemistry: PDGF-B Antibody [NBP1-58279]

Immunohistochemistry: PDGF-B Antibody [NBP1-58279] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.
Western Blot: PDGF-B Antibody [NBP1-58279]

Western Blot: PDGF-B Antibody [NBP1-58279]

Western Blot: PDGF-B Antibody [NBP1-58279] - 293T cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: PDGF-B Antibody [NBP1-58279]

Immunohistochemistry-Paraffin: PDGF-B Antibody [NBP1-58279]

Immunohistochemistry-Paraffin: PDGF-B Antibody [NBP1-58279] - Human Uterus Tissue, 4-8ug/ml.
PDGF-B Antibody

Western Blot: PDGF-B Antibody [NBP1-58279] -

Western Blot: PDGF-B Antibody [NBP1-58279] - Lanes 1-4 and 7-10 are control and lanes 5, 6, 11 and 12 were PDGF-B knockdown. Knockdown was performed with PDGF-B human siRNA using 20 nM concentration using transfection reagent. Primary antibody dilution - 1:500. Image from verified customer review.
PDGF-B Antibody

Immunocytochemistry/Immunofluorescence: Rabbit Polyclonal PDGF-B Antibody [NBP1-58279] -

Immunocytochemistry/Immunofluorescence: Rabbit Polyclonal PDGF-B Antibody [NBP1-58279] - Human primary brain microvascular endothelial cells stained for PDGF-BB (NBP1-58279), red and HSPG (NBP1-05170), green and nuclear DAPI blue. Image from a verified customer review.

Applications for PDGF-B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Validated for Immunocytochemistry/Immunofluorescence from a verified customer review.

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml
Application Notes
PDGF-B Antibody validated for Knockdown from a verified customer review.

Reviewed Applications

Read 2 reviews rated 5 using NBP1-58279 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDGF-B

PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two splice variants have been identified for this gene.

Long Name

Platelet-derived Growth Factor B

Alternate Names

C-Sis, IBGC5, PDGF-2, PDGF2, PDGFB, SIS, SSV

Gene Symbol

PDGFB

UniProt

P01127

Additional PDGF-B Products

Product Documents for PDGF-B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PDGF-B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

PDGF Family

Citations for PDGF-B Antibody - BSA Free

Customer Reviews for PDGF-B Antibody - BSA Free (2)

5 out of 5
2 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PDGF-B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 的 2 reviews Showing All
Filter By:
Clear Filters X
  • PDGF-B Antibody
    Name: KARTHIKEYAN THIRUGNANAM
    Application: Immunocytochemistry
    Sample Tested: Brain microvascular endothelial cells and HUman brain microvascular endothelial cells
    Species: Human
    Verified Customer | Posted 01/23/2024
    Human primary brain microvascular endothelial cells stained for PDGF-BB, red and HSPG, green and nuclear DAPI blue.
    PDGF-B Antibody - BSA Free NBP1-58279
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • PDGF-B Antibody
    Name: Anonymous
    Application: Knockdown Validated
    Sample Tested: 20 ug whole cell lysate
    Species: Human
    Verified Customer | Posted 03/22/2023
    Lane 1-4 and 7-10 are control and lanes 5, 6, 11 and 12 were PDGF-B knockdown.
    Knockdown was performed with PDGF-B human siRNA using 20 nM concentration using transfection reagent. Primary antibody dilution - 1:500.
    PDGF-B Antibody - BSA Free NBP1-58279
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 2 的 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies