PER2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93587

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat, Amphibian

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, ELISA, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PER2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 390-565 of human PER2 (NP_073728.1). GQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPAEKKAVPAMEKDSLGV

Reactivity Notes

Amphibian reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

137 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PER2 Antibody - BSA Free

Western Blot: PER2 AntibodyAzide and BSA Free [NBP2-93587]

Western Blot: PER2 AntibodyAzide and BSA Free [NBP2-93587]

Western Blot: PER2 Antibody [NBP2-93587] - Analysis of extracts of 293T cells, using PER2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: PER2 Antibody - Azide and BSA Free [NBP2-93587]

Immunohistochemistry-Paraffin: PER2 Antibody - Azide and BSA Free [NBP2-93587]

Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-93587] - Mouse testis using PER2 Rabbit pAb at dilution of 1:100 (40x lens).
Chromatin Immunoprecipitation: PER2 Antibody [NBP2-93587] - Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using PER2 antibody (NBP2-93587) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Western Blot: PER2 AntibodyAzide and BSA Free [NBP2-93587]

Western Blot: PER2 AntibodyAzide and BSA Free [NBP2-93587]

Western Blot: PER2 Antibody [NBP2-93587] - Analysis of extracts of Mouse liver, using PER2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: PER2 Antibody - Azide and BSA Free [NBP2-93587]

Immunohistochemistry-Paraffin: PER2 Antibody - Azide and BSA Free [NBP2-93587]

Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-93587] - Rat spleen using PER2 Rabbit pAb at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: PER2 Antibody - Azide and BSA Free [NBP2-93587]

Immunohistochemistry-Paraffin: PER2 Antibody - Azide and BSA Free [NBP2-93587]

Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-93587] - Human thyroid cancer using PER2 Rabbit pAb at dilution of 1:100 (40x lens).
PER2 Antibody

Immunohistochemistry-Frozen: Rabbit Polyclonal PER2 Antibody [NBP2-93587] -

Immunohistochemistry-Frozen: Rabbit Polyclonal PER2 Antibody [NBP2-93587] - 10X magnification. Immunoreactive cell bodies (DAB staining) along the 4th ventricle in 20um from Hyla cinerea. Image from a verified customer review.
PER2 Antibody - BSA Free

Western Blot: PER2 Antibody - BSA Free [NBP2-93587] -

Circadian gene expression varies between pHGGs and pLGGs. (A) Interleaved scatter plots represent bulk RNA sequencing (rsem FPKM) analysis comparing circadian gene expression across pediatric low-grade glioma (pLGG, n = 426, blue) and pediatric high-grade glioma (pHGG, n = 211, red) samples from the Pediatric Brain Tumor Atlas (PBTA, Provisional). Data are expressed as mean +/- SEM, and expression values are log₂-transformed FPKM counts. Statistical analysis was performed using a two-way ANOVA with Benjamini and Hochberg false discovery rate (FDR) to determine differences in gene expression between pHGGs and pLGGs. Each dot represents an individual tumor sample. Asterisks indicate statistically significant differences (*P < 0.05), while “NS" denotes non-significant comparisons. (B) Western blots of four representative pediatric high-grade glioma tissue samples (left) and four pediatric low-grade glioma tissue samples (right) comparing BMAL1, CLOCK, PER2, and REV-ERB alpha protein expression (sections of separate blots displayed; full blots are shown in Supplementary Figure S3). Of note, tissue sample HGG 3 is derived from the same patient as the STN-49 cell line. (C) Normalization to beta -ACTIN control reveals BMAL1 (p < 0.05, 1.57 vs. 0.98) and CLOCK (p < 0.05, 0.98 vs. 0.39) protein expression is higher in high-grade gliomas compared to low-grade gliomas, REV-ERB alpha is lower (p < 0.05, 0.12 vs. 0.55), and there are no significant differences in PER2 protein expression. Data are expressed as mean +/- SEM. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-025-17461-9), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PER2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

5ug antibody for 10ug-15ug of Chromatin

ELISA

Recommended starting concentration is 1 μg/mL.

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Frozen

Validated from a verified customer review

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Reviewed Applications

Read 1 review rated 5 using NBP2-93587 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PER2

PER2 is a member of the Period protein family and a mammalian homolog of the Drosphilia period gene. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Strong PER2 expression in the suprachiasmatic nuclei of the mamalian brain indicates that the PER gene functions in the circadian clock with PER2 being a component of the circadian oscillator. PER2 shares a 40% homology with PER1 including the protein dimerization PAS domain.

Alternate Names

Circadian clock protein PERIOD 2, FASPS, hPER2, KIAA0347period 2, period (Drosophila) homolog 2, period circadian protein 2, period circadian protein homolog 2, period homolog 2 (Drosophila)

Gene Symbol

PER2

Additional PER2 Products

Product Documents for PER2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PER2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for PER2 Antibody - BSA Free

Customer Reviews for PER2 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PER2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • PER2 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: brain section
    Species: Other
    Verified Customer | Posted 09/11/2023
    10X magnification. Immunoreactive cell bodies (DAB staining) along the 4th ventricle in 20um from Hyla cinerea.
    PER2 Antibody - BSA Free NBP2-93587
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies