Perilipin-3/TIP47 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49485

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Perilipin-3/TIP47 Antibody - BSA Free

Western Blot: Perilipin-3/TIP47 Antibody [NBP2-49485]

Western Blot: Perilipin-3/TIP47 Antibody [NBP2-49485]

Western Blot: Perilipin-3/TIP47 Antibody [NBP2-49485] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunocytochemistry/ Immunofluorescence: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunocytochemistry/ Immunofluorescence: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunocytochemistry/Immunofluorescence: Perilipin-3/TIP47 Antibody [NBP2-49485] - Analysis of human cell line A-431 shows positivity in vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485]

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Applications for Perilipin-3/TIP47 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Perilipin-3

TIP47 has been described as cargo protein involved in the trafficking of the mannose-6-phosphate receptor between endosomes and the Golgi complex. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. PLIN3 has been localized in milk fat globule membranes of human and bovine origin. It has also been described as a placental protein. Increased amounts of TIP47 are secreted into circulation of cervix carcinoma patients. Therefore, TIP47 is probably significant as an oncodevelopmental marker.

Alternate Names

M6PRBP1, Perilipin3, PLIN3, PP17, TIP47

Gene Symbol

PLIN3

Additional Perilipin-3 Products

Product Documents for Perilipin-3/TIP47 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Perilipin-3/TIP47 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Perilipin-3/TIP47 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Perilipin-3/TIP47 Antibody - BSA Free and earn rewards!

Have you used Perilipin-3/TIP47 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...