![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]](https://resources.rndsystems.com/images/products/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP2-55357-img0002.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]")
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Pit1 Antibody - BSA Free
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357] - Staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody NBP2-55357 (A) shows similar protein distribution across tissues to independent antibody NBP1-92273 (B).![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]](https://resources.rndsystems.com/images/products/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP2-55357-img0005.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]")
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]](https://resources.rndsystems.com/images/products/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP2-55357-img0003.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]")
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357] - Staining of human liver shows no positivity in hepatocytes as expected.![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]](https://resources.rndsystems.com/images/products/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP2-55357-img0004.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]")
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]](https://resources.rndsystems.com/images/products/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP2-55357-img0006.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]")
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357]
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-55357] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Chromatin Immunoprecipitation ChIP: Pit1 Antibody - BSA Free
ChIP-Exo-Seq composite graph for Anti-Pit1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.Applications for Pit1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Pit1
Alternate Names
CPHD1, GHF1, GHF-1pituitary-specific positive transcription factor 1, Growth hormone factor 1, PIT-1, PIT1pituitary-specific transcription factor 1, POU class 1 homeobox 1, POU domain class 1, transcription factor 1, POU domain, class 1, transcription factor 1, POU1F1a
Gene Symbol
POU1F1
Additional Pit1 Products
Product Documents for Pit1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Pit1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Pit1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Pit1 Antibody - BSA Free and earn rewards!
Have you used Pit1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...