Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39021

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35087510). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining in human stomach and liver tissues using NBP2-39021 antibody. Corresponding GALNT7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human kidney, liver, prostate and stomach using Anti-GALNT7 antibody NBP2-39021 (A) shows similar protein distribution across tissues to independent antibody NBP2-39054 (B).
Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunocytochemistry/ Immunofluorescence: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunocytochemistry/Immunofluorescence: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human cell line HaCaT shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human kidney shows very weak positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human prostate shows strong positivity in glandular cells of Golgi apparatus.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021]

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human stomach shows strong positivity in Golgi apparatus in glandular cells.
Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free [NBP2-39021] -

GALNT7 protein expression, but not mRNA expression, is altered in CD4+ T cells following activation. (A) Model of GALNT1 and GALNT7 regulation by lncSnhg7. (B, C) CD4+CD25- T conventional cells were isolated from total splenocytes. Cells were cultured in the presence of anti-CD3/CD28 magnetic beads for 0 and 16 hours for RNA or 0 and 72 hours for protein. GALNT1 and GALNT7 expression was analyzed by qPCR (B) and western blot (C). Statistical significance was assessed using ratio paired t-tests between stimulated and unstimulated samples with correction for multiple comparisons using the Holm-Šidak method in post-hoc analysis. *p < 0.05. n = 3-7 per group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35087510), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free [NBP2-39021] -

miR-34a regulates GALNT7 expression in primary T Cells. (A) Optimization of miR-34a used in nucleofection. miR-34a was overexpressed in mouse CD4+ T cells (B) or EL4 cells (C). miR-34a mRNA levels were assessed using qPCR. GALNT7 levels were measured using western blotting. Data from representative experiments are shown. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35087510), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free [NBP2-39021] -

miR-34a regulates GALNT7 expression in primary T Cells. (A) Optimization of miR-34a used in nucleofection. miR-34a was overexpressed in mouse CD4+ T cells (B) or EL4 cells (C). miR-34a mRNA levels were assessed using qPCR. GALNT7 levels were measured using western blotting. Data from representative experiments are shown. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35087510), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Polypeptide GalNAc Transferase 7/GALNT7

GALNT7 encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with non-glycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation.

Long Name

UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7

Alternate Names

GALNAC-T7, GalNAcT7, pp-GaNTase 7

Gene Symbol

GALNT7

UniProt

Additional Polypeptide GalNAc Transferase 7/GALNT7 Products

Product Documents for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Customer Reviews for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free and earn rewards!

Have you used Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...