PRA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80883

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PRA1 Antibody - BSA Free

Western Blot: PRA1 Antibody [NBP1-80883]

Western Blot: PRA1 Antibody [NBP1-80883]

Western Blot: PRA1 Antibody [NBP1-80883] - Analysis in control (vector only transfected HEK293T lysate) and RABAC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: PRA1 Antibody [NBP1-80883]

Immunocytochemistry/ Immunofluorescence: PRA1 Antibody [NBP1-80883]

Immunocytochemistry/Immunofluorescence: PRA1 Antibody [NBP1-80883] - Staining of human cell line U-251 MG shows localization to nucleoli fibrillar center and nuclear membrane.
Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883]

Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883]

Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining in human cerebral cortex and liver tissues using anti-RABAC1 antibody. Corresponding RABAC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883]

Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883]

Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883]

Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883]

Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883]

Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883]

Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human liver shows low expression as expected.

Applications for PRA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRA1

PRA1 (prenylated Rab acceptor) is a general regulator of Rab proteins. It has been shown that PRA1 interacts with Rab proteins and with VAMP2. Therefore PRA1 is probably an important factor for membrane traffic, linking together the function of Rab proteins and SNAREs (1). Human cells contain more than 60 small G proteins of the Rab family, which are localized to the surfaces of distinct membrane compartments and regulate transport vesicle formation, motility, docking and fusion. Prenylated Rabs also occur in the cytosol bound to GDI (guanine nucleotide dissociation inhibitor), which binds to Rabs in their inactive state (2).

Alternate Names

PRA1 family protein 1, PRA1PRA1 domain family 1, PRAF1prenylated Rab acceptor 1, prenylated Rab acceptor protein 1, Rab acceptor 1 (prenylated), YIP3

Entrez Gene IDs

10567 (Human)

Gene Symbol

RABAC1

UniProt

Additional PRA1 Products

Product Documents for PRA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PRA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRA1 Antibody - BSA Free and earn rewards!

Have you used PRA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...