Protocadherin-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47321

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AKSGYQAGKKETKDLYAPKPSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Protocadherin-1 Antibody - BSA Free

Western Blot: Protocadherin-1 Antibody [NBP2-47321]

Western Blot: Protocadherin-1 Antibody [NBP2-47321]

Western Blot: Protocadherin-1 Antibody [NBP2-47321] - Analysis in control (vector only transfected HEK293T lysate) and PCDH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: Protocadherin-1 Antibody [NBP2-47321]

Immunocytochemistry/ Immunofluorescence: Protocadherin-1 Antibody [NBP2-47321]

Immunocytochemistry/Immunofluorescence: Protocadherin-1 Antibody [NBP2-47321] - Staining of human cell line HaCaT shows localization to nucleoli, cell junctions & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Protocadherin-1 Antibody [NBP2-47321]

Immunohistochemistry-Paraffin: Protocadherin-1 Antibody [NBP2-47321]

Immunohistochemistry-Paraffin: Protocadherin-1 Antibody [NBP2-47321] - Staining of human cerebral cortex shows strong cytoplasmic and nucleolar positivity in neuronal cells.
Protocadherin-1 Antibody - BSA Free

Protocadherin-1 Antibody [NBP2-47321] -

Analysis in human cerebral cortex and lymph node tissues using NBP2-47321 antibody. Corresponding PCDH1 RNA-seq data are presented for the same tissues.
Protocadherin-1 Antibody - BSA Free

Protocadherin-1 Antibody [NBP2-47321] -

Staining of human small intestine shows strong membranous positivity in glandular cells.
Protocadherin-1 Antibody - BSA Free

Protocadherin-1 Antibody [NBP2-47321] -

Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Protocadherin-1 Antibody - BSA Free

Protocadherin-1 Antibody [NBP2-47321] -

Staining of human lymph node shows no positivity in germinal center cells as expected.

Applications for Protocadherin-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protocadherin-1

PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene.

Alternate Names

PC42, PCDH1, PCDH42, Protocadherin1

Gene Symbol

PCDH1

Additional Protocadherin-1 Products

Product Documents for Protocadherin-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Protocadherin-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Protocadherin-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Protocadherin-1 Antibody - BSA Free and earn rewards!

Have you used Protocadherin-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...