PUF60 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49032

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PUF60 Antibody - BSA Free

Western Blot: PUF60 Antibody [NBP2-49032]

Western Blot: PUF60 Antibody [NBP2-49032]

Western Blot: PUF60 Antibody [NBP2-49032] - Analysis using Anti-PUF60 antibody NBP2-49032 (A) shows similar pattern to independent antibody NBP2-49303 (B).
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human kidney.
Immunohistochemistry: PUF60 Antibody [NBP2-49032]

Immunohistochemistry: PUF60 Antibody [NBP2-49032]

Immunohistochemistry: PUF60 Antibody [NBP2-49032] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining in human testis and pancreas tissues using anti-PUF60 antibody. Corresponding PUF60 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human cerebral cortex, colon, kidney and testis using Anti-PUF60 antibody NBP2-49032 (A) shows similar protein distribution across tissues to independent antibody NBP2-49303 (B).
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human colon.
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human cerebral cortex.

Applications for PUF60 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PUF60

PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. PUF60 also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. PUF60 gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for PUF60 gene.

Alternate Names

FBP interacting repressor, FBP-interacting repressor, FIRpoly-U binding splicing factor PUF60, FLJ31379, FUSE-binding protein-interacting repressor, poly(U)-binding-splicing factor PUF60, poly-U binding splicing factor 60KDa, Ro ribonucleoprotein binding protein 1, Ro ribonucleoprotein-binding protein 1, Ro-binding protein 1, roBP1, ROBPI, siah binding protein 1,60 kDa poly(U)-binding-splicing factor, Siah-binding protein 1, Siah-BP1, SIAHBP1pyrimidine tract binding splicing factor

Gene Symbol

PUF60

Additional PUF60 Products

Product Documents for PUF60 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PUF60 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PUF60 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PUF60 Antibody - BSA Free and earn rewards!

Have you used PUF60 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...