RDH16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87117

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RDH16 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24648543)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RDH16 Antibody - BSA Free

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Analysis in human liver and pancreas tissues. Corresponding RDH16 RNA-seq data are presented for the same tissues.
Western Blot: RDH16 Antibody [NBP1-87117]

Western Blot: RDH16 Antibody [NBP1-87117]

Western Blot: RDH16 Antibody [NBP1-87117] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117]

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human lymph node shows no positivity as expected.

Applications for RDH16 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RDH16

Retinol dehydrogenase 16 (RDH16) is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It oxidizes 3-alpha-hydroxysteroids and also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.

Alternate Names

EC 1.1, EC 1.1.1, EC 1.1.1.105, Microsomal NAD+-dependent retinol dehydrogenase 4, retinol dehydrogenase 16, retinol dehydrogenase 16 (all-trans and 13-cis), retinol dehydrogenase 16 (all-trans), RODH4, RoDH-4, SDR9C8, short chain dehydrogenase/reductase family 9C, member 8, Sterol/retinol dehydrogenase

Entrez Gene IDs

8608 (Human)

Gene Symbol

RDH16

UniProt

O75452 (Human)

Additional RDH16 Products

Product Documents for RDH16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RDH16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RDH16 Antibody - BSA Free

Customer Reviews for RDH16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RDH16 Antibody - BSA Free and earn rewards!

Have you used RDH16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies