Regucalcin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80850

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Regucalcin Antibody - BSA Free

Western Blot: Regucalcin Antibody [NBP1-80850]

Western Blot: Regucalcin Antibody [NBP1-80850]

Western Blot: Regucalcin Antibody [NBP1-80850] - Analysis using Anti-RGN antibody NBP1-80850 (A) shows similar pattern to independent antibody NBP1-80849 (B).
Regucalcin Antibody

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] -

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Regucalcin Antibody

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] -

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] - Staining of human adrenal gland, kidney, liver and tonsil using Anti-RGN antibody NBP1-80850 (A) shows similar protein distribution across tissues to independent antibody NBP1-80849 (B).
Regucalcin Antibody

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] -

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] - Staining of human adrenal gland shows strong positivity in glandular cells.
Regucalcin Antibody

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] -

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] - Staining of human liver shows strong positivity in hepatocytes.
Regucalcin Antibody

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] -

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Regucalcin Antibody

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] -

Immunohistochemistry: Regucalcin Antibody [NBP1-80850] - Immunohistochemistry analysis in human adrenal gland and tonsil tissues using NBP1-80850 antibody. Corresponding RGN RNA-seq data are presented for the same tissues.
Regucalcin Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Regucalcin Antibody [NBP1-80850]

Immunocytochemistry/ Immunofluorescence: Regucalcin Antibody [NBP1-80850]

Staining of human cell line Hep G2 shows localization to nucleus.

Applications for Regucalcin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Regucalcin

Regucalcin is encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5' UTRs, but encoding the same protein.

Alternate Names

EC 3.1.1.17, gluconolactonase, GNL, RCsenescence marker protein-30, regucalcin (senescence marker protein-30), Senescence marker protein 30, SMP-30, SMP30regucalcin

Entrez Gene IDs

9104 (Human)

Gene Symbol

RGN

Additional Regucalcin Products

Product Documents for Regucalcin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Regucalcin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Regucalcin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Regucalcin Antibody - BSA Free and earn rewards!

Have you used Regucalcin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...