Rev-erb A alpha/NR1D1 Antibody (9I2H1)

Novus Biologicals | Catalog # NBP3-15898

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9I2H1 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 280-360 of human Rev-erb A alpha/NR1D1 (NP_068370.1). SPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Rev-erb A alpha/NR1D1 Antibody (9I2H1)

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898]

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898]

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] - Western blot analysis of extracts of various cell lines, using Rev-erb A alpha/NR1D1 antibody (NBP3-15898) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898]

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898]

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] - Western blot analysis of extracts of Mouse liver, using Rev-erb A alpha/NR1D1 antibody (NBP3-15898) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898]

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898]

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] - Western blot analysis of extracts of HepG2, using Rev-erb A alpha/NR1D1 antibody (NBP3-15898) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Rev-erb A alpha/NR1D1 Antibody (9I2H1)

Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] -

Confocal imaging of Hep G2 cells using Rev-Erb alpha /NR1D1 Rabbit mAb (A20452, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb ( dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Rev-erb A alpha/NR1D1 Antibody (9I2H1)

Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] -

Paraffin-embedded Mouse brain tissue using Rev-Erb alpha /NR1D1 Rabbit mAb, (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Applications for Rev-erb A alpha/NR1D1 Antibody (9I2H1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:400

Immunohistochemistry

1:500

Immunohistochemistry-Paraffin

1:500

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Rev-erb A alpha/NR1D1

NR1D1 functions as a constitutive transcriptional repressor. Possible receptor for triiodothyronine

Alternate Names

Ear-1, NR1D1, Reverb A alpha, THRA1, THRAL

Gene Symbol

NR1D1

Additional Rev-erb A alpha/NR1D1 Products

Product Documents for Rev-erb A alpha/NR1D1 Antibody (9I2H1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Rev-erb A alpha/NR1D1 Antibody (9I2H1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rev-erb A alpha/NR1D1 Antibody (9I2H1)

There are currently no reviews for this product. Be the first to review Rev-erb A alpha/NR1D1 Antibody (9I2H1) and earn rewards!

Have you used Rev-erb A alpha/NR1D1 Antibody (9I2H1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...