RGS20 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62667

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RGS20 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RGS20 Antibody - BSA Free

Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667]

Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667]

Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667]

Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667]

Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Analysis in human cerebral cortex and pancreas tissues using Anti-RGS20 antibody. Corresponding RGS20 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667]

Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667]

Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Staining of human pancreas shows low expression as expected.

Applications for RGS20 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGS20

Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi (see GNAI1; MIM 139310) and Gq (see GNAQ; MIM 600998) class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.[supplied by OMIM]

Alternate Names

G(z)GAP, Gz-GAP, Gz-selective GTPase-activating protein, regulator of G-protein signaling 20, Regulator of G-protein signaling Z1, regulator of G-protein signalling 20, Regulator of Gz-selective protein signaling 1, RGSZ1g(z)GAP, ZGAP1gz-GAP

Gene Symbol

RGS20

Additional RGS20 Products

Product Documents for RGS20 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RGS20 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RGS20 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGS20 Antibody - BSA Free and earn rewards!

Have you used RGS20 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies