RIN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80854

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Knockout Validated, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GEMTAWTMGARGLDKRGSFFKLIDTIASEIGELKQEMVRTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCAR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (83%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RIN2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RIN2 Antibody [NBP1-80854]

Immunocytochemistry/ Immunofluorescence: RIN2 Antibody [NBP1-80854]

Immunocytochemistry/Immunofluorescence: RIN2 Antibody [NBP1-80854] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.
RIN2 Antibody - BSA Free

Western Blot: RIN2 Antibody [NBP1-80854] -

Western Blot: RIN2 Antibody [NBP1-80854] -Analysis in human cell line PC-3 and human cell line SK-MEL-30.
RIN2 Antibody - BSA Free Immunohistochemistry-Paraffin: RIN2 Antibody [NBP1-80854]

Immunohistochemistry-Paraffin: RIN2 Antibody [NBP1-80854]

Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
RIN2 Antibody - BSA Free Immunohistochemistry-Paraffin: RIN2 Antibody [NBP1-80854]

Immunohistochemistry-Paraffin: RIN2 Antibody [NBP1-80854]

Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
RIN2 Antibody - BSA Free Immunohistochemistry-Paraffin: RIN2 Antibody [NBP1-80854]

Immunohistochemistry-Paraffin: RIN2 Antibody [NBP1-80854]

Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
RIN2 Antibody - BSA Free Immunohistochemistry-Paraffin: RIN2 Antibody [NBP1-80854]

Immunohistochemistry-Paraffin: RIN2 Antibody [NBP1-80854]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Applications for RIN2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RIN2

The RAB5 protein is a small GTPase involved in membrane trafficking in the early endocytic pathway. The protein encoded by this gene binds the GTP-bound form of the RAB5 protein preferentially over the GDP-bound form, and functions as a guanine nucleotide exchange factor for RAB5. The encoded protein is found primarily as a tetramer in the cytoplasm and does not bind other members of the RAB family.

Alternate Names

RAB5 interacting protein 2, Ras and Rab interactor 2, RAS association (RalGDS/AF-6) domain containing protein JC265, Ras association domain family 4, Ras inhibitor JC265, Ras interaction/interference protein 2, RASSF4MACS

Entrez Gene IDs

54453 (Human)

Gene Symbol

RIN2

Additional RIN2 Products

Product Documents for RIN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RIN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RIN2 Antibody - BSA Free

Customer Reviews for RIN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RIN2 Antibody - BSA Free and earn rewards!

Have you used RIN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...