RRM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47294

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RRM2 Antibody - BSA Free

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Analysis in human lymph node and skeletal muscle tissues using NBP2-47294 antibody. Corresponding RRM2 RNA-seq data are presented for the same tissues.
Western Blot: RRM2 Antibody [NBP2-47294]

Western Blot: RRM2 Antibody [NBP2-47294]

Western Blot: RRM2 Antibody [NBP2-47294] - Analysis in human cell lines U-251MG and SK-MEL-30 using anti-RRM2 antibody. Corresponding RRM2 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.
Immunocytochemistry/ Immunofluorescence: RRM2 Antibody [NBP2-47294]

Immunocytochemistry/ Immunofluorescence: RRM2 Antibody [NBP2-47294]

Immunocytochemistry/Immunofluorescence: RRM2 Antibody [NBP2-47294] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Staining of human Pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Staining of human Duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Staining of human Lymph node shows moderate cytoplasmic positivity in germinal center and non-germinal center cells.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294]

Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.

Applications for RRM2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RRM2

Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Long Name

Ribonucleotide Reductase Regulatory Subunit M2

Alternate Names

C2orf48, FLJ25102, RR2M

Gene Symbol

RRM2

Additional RRM2 Products

Product Documents for RRM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RRM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RRM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RRM2 Antibody - BSA Free and earn rewards!

Have you used RRM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...