S100A10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89370

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Rat

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for S100A10 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: S100A10 Antibody [NBP1-89370]

Immunocytochemistry/ Immunofluorescence: S100A10 Antibody [NBP1-89370]

Immunocytochemistry/Immunofluorescence: S100A10 Antibody [NBP1-89370] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
S100A10 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Analysis in human lung and skeletal muscle tissues using NBP1-89370 antibody. Corresponding S100A10 RNA-seq data are presented for the same tissues.
S100A10 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Staining of human lung shows strong membranous positivity in macrophages.
S100A10 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Analysis in human lung and skeletal muscle tissues using NBP1-89370 antibody. Corresponding S100A10 RNA-seq data are presented for the same tissues.
S100A10 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Staining of human small intestine shows strong membranous positivity in glandular cells.
S100A10 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Immunohistochemistry-Paraffin: S100A10 Antibody - BSA Free [NBP1-89370]

Staining of human skin shows strong membranous positivity in squamous epithelial cells.
S100A10 Antibody - BSA Free Western Blot: S100A10 Antibody - BSA Free [NBP1-89370]

Western Blot: S100A10 Antibody - BSA Free [NBP1-89370]

Analysis in human cell lines Caco-2 and HEK293 using Anti-S100A10 antibody. Corresponding S100A10 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
S100A10 Antibody - BSA Free Western Blot: S100A10 Antibody - BSA Free [NBP1-89370]

Western Blot: S100A10 Antibody - BSA Free [NBP1-89370]

Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-S100A10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
S100A10 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: S100A10 Antibody - BSA Free [NBP1-89370] -

The AT2-blocker PD123319 induces S100A10 expression in astrocytes with increased proliferation whereas Telmisartan does not affect S100A10 or Ki67 expression. *p < 0.05, **p < 0.01, and ***p < 0.001 compared different experimental groups as marked by horizontal bar; graphs depict mean values +/- standard error of the mean (SEM). A Experimental timeline. Three to five days after subculturing, astrocytes were left unstimulated or treated with 10 uM telmisartan or 10 uM PD123319 for 48 h. They were then exposed to 2 h of oxygen–glucose deprivation (OGD) before they were allowed to recover in regular culture medium for 24 h. Afterward, the cells were used for further experiments. Unstimulated astrocytes, which were exposed to 2 h of OGD, served as controls. B S100A10 marker expression in untreated (unstimulated) or OGD-treated (2 h of OGD) astrocytes with or without the additional preincubation with 10 uM telmisartan or 10 uM PD123319. C Proliferation rate of untreated (unstimulated) and OGD-treated (2 h OGD) astrocytes, with or without preincubation with 10 uM telmisartan or 10 uM PD123319 over 48 h as assessed by mRNA-ki67 expression. D ATP concentration of untreated or OGD-treated astrocytes with or without preincubation with 10 uM telmisartan or 10 uM PD123319 over 48 h. E Expression of the connexin Cx43 in untreated or OGD-treated astrocytes with or without preincubation with 10 uM telmisartan and 10 uM PD123319 over 48 h. F Representative immunocytochemical stainings of astrocytes with Glia Fibrillary Acidic Protein (GFAP) + (green) and S100A10 + (red) in unstimulated (control), PD123319-preincubated (PD123319), or after 2 h of OGD (OGD + Control). Hoechst stained all cell nuclei blue; scale bars = 50 um Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38926677), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for S100A10 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S100A10

S100A10 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.

Long Name

S100 Calcium Binding Protein

Alternate Names

annexin II ligand, calpactin I, light polypeptide, ANX2L, ANX2LG, CAL1LGP11,42C, Calpactin I light chain, Calpactin-1 light chain, Cellular ligand of annexin II, CLP11Ca[1], MGC111133, p10, p10 protein, p11, protein S100-A10, S100 calcium binding protein A10, S100 calcium binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11)), S100 calcium-binding protein A10, S100 calcium-binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))

Gene Symbol

S100A10

Additional S100A10 Products

Product Documents for S100A10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S100A10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for S100A10 Antibody - BSA Free

Customer Reviews for S100A10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review S100A10 Antibody - BSA Free and earn rewards!

Have you used S100A10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...