SAV1 Antibody (3B2) - Azide and BSA Free

Novus Biologicals | Catalog # H00060485-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Yeast

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3B2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26913567).

Specificity

SAV1 - salvador homolog 1 (Drosophila)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for SAV1 Antibody (3B2) - Azide and BSA Free

Western Blot: SAV1 Antibody (3B2) [H00060485-M02]

Western Blot: SAV1 Antibody (3B2) [H00060485-M02]

SAV1-Antibody-3B2-Western-Blot-H00060485-M02-img0012.jpg
Immunocytochemistry/ Immunofluorescence: SAV1 Antibody (3B2) [H00060485-M02]

Immunocytochemistry/ Immunofluorescence: SAV1 Antibody (3B2) [H00060485-M02]

Immunocytochemistry/Immunofluorescence: SAV1 Antibody (3B2) [H00060485-M02] - Analysis of monoclonal antibody to SAV1 on HeLa cell. Antibody concentration 60 ug/ml.
Western Blot: SAV1 Antibody (3B2) [H00060485-M02]

Western Blot: SAV1 Antibody (3B2) [H00060485-M02]

Western Blot: SAV1 Antibody (3B2) [H00060485-M02] - SAV1 monoclonal antibody (M02), clone 3B2. Analysis of SAV1 expression in HepG2.
Immunoprecipitation: SAV1 Antibody (3B2) [H00060485-M02]

Immunoprecipitation: SAV1 Antibody (3B2) [H00060485-M02]

Immunoprecipitation: SAV1 Antibody (3B2) [H00060485-M02] - Analysis of SAV1 transfected lysate using anti-SAV1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SAV1 MaxPab rabbit polyclonal antibody.
ELISA: SAV1 Antibody (3B2) [H00060485-M02]

ELISA: SAV1 Antibody (3B2) [H00060485-M02]

ELISA: SAV1 Antibody (3B2) [H00060485-M02] - Detection limit for recombinant GST tagged SAV1 is approximately 0.1ng/ml as a capture antibody.
SAV1 Antibody (3B2)

Western Blot: SAV1 Antibody (3B2) [H00060485-M02] -

Western Blot: SAV1 Antibody (3B2) [H00060485-M02] - MST2 & SAV1 increase the levels of PPAR gamma by increasing its protein stability.(A) Increasing amounts (0.5, 1, 3 µg) of Myc-SAV1 were co-expressed with Flag-PPAR gamma and/or HA-MST2 in 293 cells. At 48 h after transfection, cell lysates were immunoblotted with the indicated antibodies. (B) Flag-tagged PPAR gamma or PPAR gamma (128–505) was co-expressed with HA-MST2, HA-MST2-KD (inactive mutant), Myc-SAV1, and/or Myc-SAV1(1–201) in 293 cells as indicated. Cell lysates were prepared at various times after treatment with 40 µg/mL cycloheximide & then immunoblotted with an anti-Flag antibody. The PPAR gamma protein expression was quantified & the half-life of PPAR gamma protein was calculated. Expression of GAPDH was detected as a loading control. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/22292086), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SAV1 Antibody (3B2) - Azide and BSA Free

Application
Recommended Usage

ELISA

1:100-1:2000

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Immunoprecipitation

1:10-1:500

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 26913567).

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SAV1

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a coiled-coil region. It is ubiquitously expressed in adult tissues. The encoded protein is 94% identical to the mouse protein at the amino acid level.

Alternate Names

45 kDa WW domain protein, hWW45, protein salvador homolog 1, salvador homolog 1 (Drosophila), SAV, WW domain-containing, WW45salvador, WWP4,1700040G09Rik

Entrez Gene IDs

60485 (Human)

Gene Symbol

SAV1

OMIM

607203 (Human)

Additional SAV1 Products

Product Documents for SAV1 Antibody (3B2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SAV1 Antibody (3B2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SAV1 Antibody (3B2) - Azide and BSA Free

Customer Reviews for SAV1 Antibody (3B2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SAV1 Antibody (3B2) - Azide and BSA Free and earn rewards!

Have you used SAV1 Antibody (3B2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...