SCAF8/RBM16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34015

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LSMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISSGENTRSVIPNDISSNAAILG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SCAF8/RBM16 Antibody - BSA Free

Western Blot: SCAF8/RBM16 Antibody [NBP2-34015]

Western Blot: SCAF8/RBM16 Antibody [NBP2-34015]

Western Blot: SCAF8/RBM16 Antibody [NBP2-34015] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015] - Staining of human colon.
Immunohistochemistry: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry: SCAF8/RBM16 Antibody [NBP2-34015] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.
Immunohistochemistry: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry: SCAF8/RBM16 Antibody [NBP2-34015] - Staining of skin.
Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015] - Staining of lymphoma.
Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015] - Staining of human cerebral cortex, colon, kidney and testis using Anti-SCAF8 antibody NBP2-34015 (A) shows similar protein distribution across tissues to independent antibody NBP1-87386 (B).
Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015] - Staining of human kidney.
Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015]

Immunohistochemistry-Paraffin: SCAF8/RBM16 Antibody [NBP2-34015] - Staining of human testis.
SCAF8/RBM16 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: SCAF8/RBM16 Antibody [NBP2-34015]

Immunocytochemistry/ Immunofluorescence: SCAF8/RBM16 Antibody [NBP2-34015]

Staining of human cell line U-2 OS shows localization to nucleoplasm.

Applications for SCAF8/RBM16 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCAF8/RBM16

SCAF8/RBM16 (SR-related and CTD-associated factor 8) contains an RNA recognition motif found in a variety of RNA binding proteins that function in RNA processing. The function of SCAF8 is unknown.

Alternate Names

CCAP7, CDC5L complex-associated protein 7, KIAA1116RNA-binding protein 16, putative RNA-binding protein 16, RBM16, RNA binding motif protein 16, RNA-binding motif protein 16, SR-like CTD-associated factor 8, SR-related and CTD-associated factor 8, SR-related CTD-associated factor 8

Gene Symbol

SCAF8

UniProt

Additional SCAF8/RBM16 Products

Product Documents for SCAF8/RBM16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SCAF8/RBM16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCAF8/RBM16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCAF8/RBM16 Antibody - BSA Free and earn rewards!

Have you used SCAF8/RBM16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...