Schlafen 11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92368

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAVFSEAPNSWI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Schlafen 11 Antibody - BSA Free

Western Blot: Schlafen 11 Antibody [NBP1-92368]

Western Blot: Schlafen 11 Antibody [NBP1-92368]

Western Blot: Schlafen 11 Antibody [NBP1-92368] - Analysis in human cell lines HEK293 and Caco-2 using anti-SLFN11 antibody. Corresponding SLFN11 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.
Immunocytochemistry/ Immunofluorescence: Schlafen 11 Antibody [NBP1-92368]

Immunocytochemistry/ Immunofluorescence: Schlafen 11 Antibody [NBP1-92368]

Immunocytochemistry/Immunofluorescence: Schlafen 11 Antibody [NBP1-92368] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Western Blot: Schlafen 11 Antibody [NBP1-92368]

Western Blot: Schlafen 11 Antibody [NBP1-92368]

Western Blot: Schlafen 11 Antibody [NBP1-92368] - Analysis in human cell line MOLT-4.
Simple Western: Schlafen 11 Antibody [NBP1-92368]

Simple Western: Schlafen 11 Antibody [NBP1-92368]

Simple Western: Schlafen 11 Antibody [NBP1-92368] - Simple Western lane view shows a specific band for SLFN11 in 0.2 mg/ml of MOLT-4 (left), HEK 239T (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: Schlafen 11 Antibody [NBP1-92368]

Simple Western: Schlafen 11 Antibody [NBP1-92368]

Simple Western: Schlafen 11 Antibody [NBP1-92368] - Electropherogram image(s) of corresponding Simple Western lane view. Schlafen 8 antibody was used at 1:20 dilution on MOLT-4 and HEK 239T lysate(s).

Applications for Schlafen 11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in MOLT-4, HEK 239T, separated by Size, antibody dilution of 1:20, apparent MW was 102 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Schlafen 11

Alternate Names

FLJ34922, schlafen family member 11

Gene Symbol

SLFN11

Additional Schlafen 11 Products

Product Documents for Schlafen 11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Schlafen 11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Schlafen 11 Antibody - BSA Free

Customer Reviews for Schlafen 11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Schlafen 11 Antibody - BSA Free and earn rewards!

Have you used Schlafen 11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...