SEC63 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30405

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SEC63 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: REYQEYNPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SEC63 Antibody - BSA Free

Western Blot: SEC63 Antibody [NBP2-30405]

Western Blot: SEC63 Antibody [NBP2-30405]

Western Blot: SEC63 Antibody [NBP2-30405] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Immunocytochemistry/ Immunofluorescence: SEC63 Antibody [NBP2-30405]

Immunocytochemistry/ Immunofluorescence: SEC63 Antibody [NBP2-30405]

Immunocytochemistry/Immunofluorescence: SEC63 Antibody [NBP2-30405] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Analysis in human testis and skeletal muscle tissues using NBP2-30405 antibody. Corresponding SEC63 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human salivary gland shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405]

Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for SEC63 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC63

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER.

Alternate Names

PRO2507, SEC63 homolog (S. cerevisiae), SEC63LERdj2, SEC63-like (S. cerevisiae), translocation protein SEC63 homolog

Gene Symbol

SEC63

UniProt

Q9UGP8 (Human)

Additional SEC63 Products

Product Documents for SEC63 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEC63 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SEC63 Antibody - BSA Free

Customer Reviews for SEC63 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC63 Antibody - BSA Free and earn rewards!

Have you used SEC63 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies