SHIP Antibody (2F8U0)

Novus Biologicals | Catalog # NBP3-16226

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2F8U0 expressed in HEK293
View all SHIP Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1084-1178 of human SHIP1 (Q92835). RSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SHIP Antibody (2F8U0) (NBP3-16226) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SHIP Antibody (2F8U0)

Western Blot: SHIP Antibody (2F8U0) [NBP3-16226]

Western Blot: SHIP Antibody (2F8U0) [NBP3-16226]

Western Blot: SHIP Antibody (2F8U0) [NBP3-16226] - Western blot analysis of extracts of various cell lines, using SHIP1 Rabbit mAb (NBP3-16226) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: SHIP Antibody (2F8U0) [NBP3-16226]

Immunohistochemistry-Paraffin: SHIP Antibody (2F8U0) [NBP3-16226]

Immunohistochemistry-Paraffin: SHIP Antibody (2F8U0) [NBP3-16226] - Immunohistochemistry of paraffin-embedded human spleen using SHIP1 Rabbit mAb (NBP3-16226) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
SHIP Antibody (2F8U0)

Immunocytochemistry/ Immunofluorescence: SHIP Antibody (2F8U0) [NBP3-16226] -

Immunocytochemistry/ Immunofluorescence: SHIP Antibody (2F8U0) [NBP3-16226] - Immunofluorescence analysis of paraffin-embedded rat spleen using SHIP1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SHIP Antibody (2F8U0)

Immunocytochemistry/ Immunofluorescence: SHIP Antibody (2F8U0) [NBP3-16226] -

Immunocytochemistry/ Immunofluorescence: SHIP Antibody (2F8U0) [NBP3-16226] - Immunofluorescence analysis of paraffin-embedded human spleen using SHIP1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SHIP Antibody (2F8U0)

Immunocytochemistry/ Immunofluorescence: SHIP Antibody (2F8U0) [NBP3-16226] -

Immunocytochemistry/ Immunofluorescence: SHIP Antibody (2F8U0) [NBP3-16226] - Immunofluorescence analysis of paraffin-embedded mouse spleen using SHIP1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for SHIP Antibody (2F8U0)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SHIP

SH2-containing inositol phosphatase 1 (SHIP) is a 145 kDa hemopoietic-specific phosphatase that hydrolyzes phosphatidylinositol-3,4,5-triphosphate to phosphatidylinositol-3, 4-bisphosphate. SHIP has been shown to bind directly a phosphorylated motif, immunoreceptor tyrosine-based inhibition motif (ITIM), present in the cytoplasmic domain of FcgammaRIIB1 (1). Also, results demonstrate that FcgammaRIIB use SHIP1 to inhibit pathways shared by receptor tyrosine kinases and immunoreceptors to trigger cell proliferation and cell activation, respectively (2).

Long Name

SH2-containing Inositol Phosphatase

Alternate Names

INPP5D

Gene Symbol

INPP5D

Additional SHIP Products

Product Documents for SHIP Antibody (2F8U0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SHIP Antibody (2F8U0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SHIP Antibody (2F8U0)

There are currently no reviews for this product. Be the first to review SHIP Antibody (2F8U0) and earn rewards!

Have you used SHIP Antibody (2F8U0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies