Signal Peptide Peptidase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92389

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Signal Peptide Peptidase Antibody - BSA Free

Signal Peptide Peptidase Antibody - BSA Free Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.
Signal Peptide Peptidase Antibody - BSA Free Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Signal Peptide Peptidase Antibody - BSA Free Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Signal Peptide Peptidase Antibody - BSA Free Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Signal Peptide Peptidase Antibody - BSA Free Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Immunohistochemistry: Signal Peptide Peptidase Antibody - BSA Free [NBP1-92389]

Analysis in human pancreas and skeletal muscle tissues using NBP1-92389 antibody. Corresponding HM13 RNA-seq data are presented for the same tissues.

Applications for Signal Peptide Peptidase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Signal Peptide Peptidase

Signal Peptide Peptidase is encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-E epitopes that are recognized by the immune system, and to process hepatitis C virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

dJ324O17.1, EC 3.4.23.-, H13hIMP1, histocompatibility (minor) 13, IMP-1, IMP1MSTP086, Intramembrane protease 1, minor histocompatibility antigen 13, minor histocompatibility antigen H13, Presenilin-like protein 3, PSENL3, PSL3IMPAS, Signal peptide peptidase, signal peptide peptidase beta, SPPIMPAS-1

Gene Symbol

HM13

Additional Signal Peptide Peptidase Products

Product Documents for Signal Peptide Peptidase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Signal Peptide Peptidase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Signal Peptide Peptidase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Signal Peptide Peptidase Antibody - BSA Free and earn rewards!

Have you used Signal Peptide Peptidase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...