Signal sequence receptor delta Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-92390
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Signal sequence receptor delta Antibody - BSA Free
Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390]
Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Analysis in human pancreas and skeletal muscle tissues using NBP1-92390 antibody. Corresponding SSR4 RNA-seq data are presented for the same tissues.Western Blot: Signal sequence receptor delta Antibody [NBP1-92390]
Western Blot: Signal sequence receptor delta Antibody [NBP1-92390] - Analysis in human cell line AN3-CA.Western Blot: Signal sequence receptor delta Antibody [NBP1-92390]
Western Blot: Signal sequence receptor delta Antibody [NBP1-92390] - Analysis of human dermal fibroblasts at 1:500 dilution. Image submitted by a verified customer review.Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390]
Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human kidney shows low expression as expected.Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390]
Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390]
Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human colon shows moderate to strong cytoplasmic positivity in lymphoid cells.Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390]
Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human kidney shows no positivity in cells in tubules as expected.Western Blot: Signal sequence receptor delta Antibody - BSA Free [NBP1-92390]
Analysis in human cell line AN3-CA.Immunohistochemistry: Signal sequence receptor delta Antibody - BSA Free [NBP1-92390]
Staining of human skeletal muscle shows no positivity in myocytes as expected.Applications for Signal sequence receptor delta Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 -1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 4 using NBP1-92390 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Signal sequence receptor delta
Alternate Names
signal sequence receptor, delta (translocon-associated protein delta), SSR-delta, translocon-associated protein delta, translocon-associated protein subunit delta, TRAP-delta, TRAPDSignal sequence receptor subunit delta
Gene Symbol
SSR4
Additional Signal sequence receptor delta Products
Product Documents for Signal sequence receptor delta Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Signal sequence receptor delta Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Signal sequence receptor delta Antibody - BSA Free
Customer Reviews for Signal sequence receptor delta Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used Signal sequence receptor delta Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: human dermal fibroblastsSpecies: HumanVerified Customer | Posted 02/27/2014SSR4 detection in fibroblasts
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...