SLC25A13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89019

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC25A13 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLIS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC25A13 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Analysis in human liver and skeletal muscle tissues using NBP1-89019 antibody. Corresponding SLC25A13 RNA-seq data are presented for the same tissues.
Western Blot: SLC25A13 Antibody [NBP1-89019]

Western Blot: SLC25A13 Antibody [NBP1-89019]

Western Blot: SLC25A13 Antibody [NBP1-89019] - Analysis in human cell line NTERA-2.
Immunocytochemistry/ Immunofluorescence: SLC25A13 Antibody [NBP1-89019]

Immunocytochemistry/ Immunofluorescence: SLC25A13 Antibody [NBP1-89019]

Immunocytochemistry/Immunofluorescence: SLC25A13 Antibody [NBP1-89019] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019]

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Applications for SLC25A13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in Liver, separated by Size

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC25A13

The SLC25A13 gene is a member of the mitochondrial carrier family. The encoded protein contains four EF-hand Ca(2+) binding motifs in the N-terminal domain, and localizes to mitochondria. The protein catalyzes the exchange of aspartate for glutamate and a proton

Alternate Names

ARALAR2CTLN2, calcium-binding mitochondrial carrier protein Aralar2, CITRIN, Mitochondrial aspartate glutamate carrier 2, Solute carrier family 25 member 13, solute carrier family 25, member 13 (citrin)

Gene Symbol

SLC25A13

Additional SLC25A13 Products

Product Documents for SLC25A13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC25A13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLC25A13 Antibody - BSA Free

Customer Reviews for SLC25A13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A13 Antibody - BSA Free and earn rewards!

Have you used SLC25A13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies