SLC39A11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-16004

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 101-174 of mouse Slc39a11 (NP_001159975.1). HLGATEDPQTALALNLDPALMKKSDPRDPTSLLFPESELSIRIGSTGLLSDKRENGEVYQRKKVAATDLAEGVA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC39A11 Antibody - BSA Free

Western Blot: SLC39A11 AntibodyAzide and BSA Free [NBP3-16004]

Western Blot: SLC39A11 AntibodyAzide and BSA Free [NBP3-16004]

Western Blot: SLC39A11 Antibody [NBP3-16004] - Western blot analysis of extracts of various cell lines, using SLC39A11 antibody (NBP3-16004) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody [NBP3-16004] - Immunohistochemistry of paraffin-embedded rat stomach using SLC39A11 Rabbit pAb (NBP3-16004) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody [NBP3-16004] - Immunohistochemistry of paraffin-embedded human breast cancer using SLC39A11 Rabbit pAb (NBP3-16004) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody [NBP3-16004] - Immunohistochemistry of paraffin-embedded human placenta using SLC39A11 Rabbit pAb (NBP3-16004) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody [NBP3-16004] - Immunohistochemistry of paraffin-embedded mouse kidney using SLC39A11 Rabbit pAb (NBP3-16004) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody - Azide and BSA Free [NBP3-16004]

Immunohistochemistry-Paraffin: SLC39A11 Antibody [NBP3-16004] - Immunohistochemistry of paraffin-embedded mouse lung using SLC39A11 Rabbit pAb (NBP3-16004) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for SLC39A11 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC39A11

SLC39A11 may act as a zinc-influx transporter

Alternate Names

C17orf26, chromosome 17 open reading frame 26, solute carrier family 39 (metal ion transporter), member 11, Solute carrier family 39 member 11, zinc transporter ZIP11, ZIP11, ZIP-11, Zrt- and Irt-like protein 11

Gene Symbol

SLC39A11

Additional SLC39A11 Products

Product Documents for SLC39A11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC39A11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC39A11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC39A11 Antibody - BSA Free and earn rewards!

Have you used SLC39A11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...