SLC6A19 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-48784
![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]](https://resources.rndsystems.com/images/products/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0007.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNK
Reactivity Notes
Mouse (84%), Rat (87%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SLC6A19 Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: SLC6A19 Antibody [NBP2-48784]](https://resources.rndsystems.com/images/products/SLC6A19-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48784-img0006.jpg "Immunocytochemistry/ Immunofluorescence: SLC6A19 Antibody [NBP2-48784]")
Immunocytochemistry/ Immunofluorescence: SLC6A19 Antibody [NBP2-48784]
Immunocytochemistry/Immunofluorescence: SLC6A19 Antibody [NBP2-48784] - Staining of human cell line HEL shows localization to nucleoli. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]](https://resources.rndsystems.com/images/products/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0014.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]")
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human pancreas shows no membranous positivity in exocrine glanular cells as expected.![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]](https://resources.rndsystems.com/images/products/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0009.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]")
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]](https://resources.rndsystems.com/images/products/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0010.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]")
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]](https://resources.rndsystems.com/images/products/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0011.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]")
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]](https://resources.rndsystems.com/images/products/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0012.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]")
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human kidney shows strong membranous positivity in cells in tubules.![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]](https://resources.rndsystems.com/images/products/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0013.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]")
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784]
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human stomach shows no membranous positivity in glandular cells as expected.Applications for SLC6A19 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:2500 - 1:5000
Immunohistochemistry-Paraffin
1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLC6A19
Alternate Names
B0AT1, FLJ20680, FLJ34635, HND, sodium-dependent amino acid transporter system B0, sodium-dependent neutral amino acid transporter B(0)AT1, solute carrier family 6 (neurotransmitter transporter), member 19, solute carrier family 6 (neutral amino acid transporter), member 19, Solute carrier family 6 member 19, System B(0) neutral amino acid transporter AT1, system B0 neutral amino acid transporter
Gene Symbol
SLC6A19
Additional SLC6A19 Products
Product Documents for SLC6A19 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC6A19 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SLC6A19 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLC6A19 Antibody - BSA Free and earn rewards!
Have you used SLC6A19 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...