Smoothelin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37971

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Smoothelin Antibody - BSA Free

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Analysis in human prostate and liver tissues. Corresponding Smoothelin RNA-seq data are presented for the same tissues.
Western Blot: Smoothelin Antibody [NBP2-37971]

Western Blot: Smoothelin Antibody [NBP2-37971]

Western Blot: Smoothelin Antibody [NBP2-37971] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Staining of human rectum shows moderate to strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971]

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Applications for Smoothelin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Simple Western

1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in Bladder, separated by Size, antibody dilution of 1:50

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Smoothelin

Smoothelin is a constituent of the smooth muscle cell (SMC) cytoskeleton. Antibodies directed to smoothelin are a useful tool to monitor SMC differentiation. Smoothelin is exclusively expressed in fully differentiated (contractile) SMCs. RNA and protein analyses reveal a broad species distribution of this protein. Cells with SMC like characteristics, such as myofibroblasts, myoepithelial cells, and skeletal and cardiac muscle do not contain smoothelin. Confocal scanning laser microscopy of tissue sections, as well as transfection studies, show a filamentous organization of smoothelin that is different from that of desmin and vimentin. Smoothelin colocalizes with actin stress fibers. Two tissue specific isoforms have been identified: a 59 kDa isoform specific for visceral SMC; and a 100 kDa specific for vascular SMC. Human smoothelin is encoded by a single copy gene which is located on chromosome 22. The distribution of smoothelin positive cells indicates a correlation between smoothelin expression and smooth muscle tissue contractility. Smoothelin is a useful tool in the evaluation of atherosclerotic lesions.

Alternate Names

SMSMO, SMTN

Gene Symbol

SMTN

UniProt

Additional Smoothelin Products

Product Documents for Smoothelin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Smoothelin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Smoothelin Antibody - BSA Free

Customer Reviews for Smoothelin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Smoothelin Antibody - BSA Free and earn rewards!

Have you used Smoothelin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...