SNX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13359

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SNX1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: GGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SNX1 Antibody - BSA Free

SNX1 Antibody - BSA Free Western Blot: SNX1 Antibody - BSA Free [NBP2-13359]

Western Blot: SNX1 Antibody - BSA Free [NBP2-13359]

Analysis using antibody NBP2-13359 (A) shows similar pattern to independent antibody NBP2-56957 (B).
Immunocytochemistry/ Immunofluorescence: SNX1 Antibody [NBP2-13359]

Immunocytochemistry/ Immunofluorescence: SNX1 Antibody [NBP2-13359]

Immunocytochemistry/Immunofluorescence: SNX1 Antibody [NBP2-13359] - Staining of human cell line HeLa shows localization to endosomes & lysosomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SNX1 Antibody [NBP2-13359]

Immunohistochemistry-Paraffin: SNX1 Antibody [NBP2-13359]

Immunohistochemistry-Paraffin: SNX1 Antibody [NBP2-13359] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.
SNX1 Antibody - BSA Free Western Blot: SNX1 Antibody - BSA Free [NBP2-13359]

Western Blot: SNX1 Antibody - BSA Free [NBP2-13359]

Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Applications for SNX1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNX1

SNX1 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. This protein also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members. This gene results in three transcript variants encoding distinct isoforms.

Alternate Names

HsT17379, MGC8664, SNX1Asorting nexin 1A, sorting nexin 1, sorting nexin-1, Vps5

Gene Symbol

SNX1

Additional SNX1 Products

Product Documents for SNX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SNX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNX1 Antibody - BSA Free and earn rewards!

Have you used SNX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies