Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Novus Biologicals | Catalog # NBP3-15427

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Multiplex Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, COMET

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3L6F0 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sodium Potassium ATPase Alpha 1 (P05023). MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) Detection of Sodium Potassium ATPase Antibody in Human Kidney via seqIF™ staining on COMET™

Detection of Sodium Potassium ATPase Antibody in Human Kidney via seqIF™ staining on COMET™

Sodium Potassium ATPase was detected in immersion fixed paraffin-embedded sections of human kidney using Rabbit Anti-Human Sodium Potassium ATPase, Monoclonal Antibody (Catalog #NBP3-15427) at a 1:8000 dilution at 37° Celsius for 2 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the membrane. Protocol available in COMET™ Panel Builder.
Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427]

Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427]

Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of NIH-3T3 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427]

Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427]

Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of C6 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] -

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of extracts from HeLa cells, using Na+/K+-ATPase Rabbit mAb at 1:50000 dilution.Membrane protein extract isolated from Hela cells. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] -

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of various lysates, using Na+/K+-ATPase Rabbit mAb at 1:50000 dilution. Membrane protein extract isolated from Hela cells. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] -

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human colon using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] -

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human kidney using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] -

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human thyroid cancer using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] -

Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Sodium Potassium ATPase Alpha 1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] -

Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Confocal imaging of human colon using Sodium Potassium ATPase Alpha 1 Rabbit mAb. DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] -

Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Sodium Potassium ATPase Alpha 1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] -

Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Sodium Potassium ATPase Alpha 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:1000

Immunohistochemistry

1:3000 - 1:12000

Immunohistochemistry-Paraffin

1:3000 - 1:12000

Multiplex Immunofluorescence

1:8000

Western Blot

1:50000 - 1:200000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sodium Potassium ATPase Alpha 1

Sodium Potassium ATPase is an integral membrane protein complex that hydrolyzes ATP to maintain the transmembrane gradients of Na+ and K+ found in most mammalian cells. The Sodium Potassium ATPase enzyme is comprised of an alpha and beta subunit. The alpha-polypeptide (Sodium Potassium ATPase Alpha 1) has been shown to be the catalytically active subunit, whereas the Beta-polypeptide appears to be necessary for the assembly and transport of the sodium pump to the plasma membrane. Sodium Potassium ATPase alpha-1 subunit, in the brain, is expressed in both neuronal and non-neuronal cells.

Long Name

Sodium/potassium-transporting ATPase subunit alpha-1

Alternate Names

ATP1A1, EC 7.2.2.13

Gene Symbol

ATP1A1

Additional Sodium Potassium ATPase Alpha 1 Products

Product Documents for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

There are currently no reviews for this product. Be the first to review Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) and earn rewards!

Have you used Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Showing  1 - 11 FAQ Showing All
  • Q: I am looking forward to pick up a plasma membrane marker. I have gastric cancer cell line and I am preparing PM out of that. To just check the quality of prep, I need a plasma membrane marker.

    A:

    Our sodium potassium ATPase and plasma membrane products may be of use to you. Please contact us at technical@novusbio.com with any additional questions.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...