Solute carrier family 22 member 18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57503

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Solute carrier family 22 member 18 Antibody - BSA Free

Immunohistochemistry-Paraffin: Solute carrier family 22 member 18 Antibody [NBP2-57503]

Immunohistochemistry-Paraffin: Solute carrier family 22 member 18 Antibody [NBP2-57503]

Immunohistochemistry-Paraffin: Solute carrier family 22 member 18 Antibody [NBP2-57503] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: Solute carrier family 22 member 18 Antibody [NBP2-57503]

Immunohistochemistry-Paraffin: Solute carrier family 22 member 18 Antibody [NBP2-57503]

Immunohistochemistry-Paraffin: Solute carrier family 22 member 18 Antibody [NBP2-57503] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Solute carrier family 22 member 18 Antibody [NBP2-57503]

Immunohistochemistry-Paraffin: Solute carrier family 22 member 18 Antibody [NBP2-57503]

Immunohistochemistry-Paraffin: Solute carrier family 22 member 18 Antibody [NBP2-57503] - Staining in human small intestine and liver tissues using anti-SLC22A18 antibody. Corresponding SLC22A18 RNA-seq data are presented for the same tissues.

Applications for Solute carrier family 22 member 18 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Solute carrier family 22 member 18

Solute carrier family 22 member 18 is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney. Two alternative transcripts encoding the same isoform have been described.

Alternate Names

BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein

Gene Symbol

SLC22A18

Additional Solute carrier family 22 member 18 Products

Product Documents for Solute carrier family 22 member 18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Solute carrier family 22 member 18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Solute carrier family 22 member 18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Solute carrier family 22 member 18 Antibody - BSA Free and earn rewards!

Have you used Solute carrier family 22 member 18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...