SPERT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86592

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Rat (93%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ASQHSYPLNRFSSVPLDPMERPMSQADLELDYNPPRVQLSDEMFVFQDGRWVNENCRLQSPYFSPSASFHHKLHHK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SPERT Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SPERT Antibody [NBP1-86592]

Immunocytochemistry/ Immunofluorescence: SPERT Antibody [NBP1-86592]

Immunocytochemistry/Immunofluorescence: SPERT Antibody [NBP1-86592] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cell junctions.
SPERT Antibody - BSA Free Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Analysis in human testis and liver tissues Corresponding SPERT RNA-seq data are presented for the same tissues.
SPERT Antibody - BSA Free Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Staining of human gastrointestinal, kidney, liver and testis using Anti-SPERT antibody NBP1-86592 (A) shows similar protein distribution across tissues to independent antibody NBP1-86593 (B).
SPERT Antibody - BSA Free Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Staining of human small intestine shows no positivity in glandular cells as expected.
SPERT Antibody - BSA Free Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Staining of human kidney shows no positivity in cells in tubules as expected.
SPERT Antibody - BSA Free Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Staining of human liver shows no positivity in hepatocytes as expected.
SPERT Antibody - BSA Free Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Immunohistochemistry-Paraffin: SPERT Antibody - BSA Free [NBP1-86592]

Staining of human gastrointestinal, kidney, liver and testis HPA040046 (A) shows similar protein distribution across tissues to independent antibody HPA039359 (B).

Applications for SPERT Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPERT

Alternate Names

CBY2spermatid flower-like structure protein, chibby homolog 2, FLJ35810, novel leucine zipper testicular protein, NURIT, Protein chibby homolog 2, spermatid associated, spermatid-associated protein, testis specific leucine zipper protein nurit, testis-specific leucine zipper protein nurit

Gene Symbol

SPERT

Additional SPERT Products

Product Documents for SPERT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPERT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPERT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPERT Antibody - BSA Free and earn rewards!

Have you used SPERT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...