Sphingomyelin Synthase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92436

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sphingomyelin Synthase 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436]

Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436]

Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Analysis in human gallbladder and skeletal muscle tissues. Corresponding SGMS2 RNA-seq data are presented for the same tissues.
Sphingomyelin Synthase 2 Antibody - BSA Free Western Blot: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Western Blot: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Sphingomyelin Synthase 2 Antibody - BSA Free Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Staining of human gallbladder shows strong membranous positivity in glandular cells.
Sphingomyelin Synthase 2 Antibody - BSA Free Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Analysis in human gallbladder and skeletal muscle tissues using NBP1-92436 antibody. Corresponding SGMS2 RNA-seq data are presented for the same tissues.
Sphingomyelin Synthase 2 Antibody - BSA Free Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Staining of human lung shows moderate membranous positivity in pneumocytes.
Sphingomyelin Synthase 2 Antibody - BSA Free Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Staining of human small intestine shows moderate membranous positivity in glandular cells.
Sphingomyelin Synthase 2 Antibody - BSA Free Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Staining of human Fallopian tube shows weak membranous positivity in glandular cells.
Sphingomyelin Synthase 2 Antibody - BSA Free Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Immunohistochemistry: Sphingomyelin Synthase 2 Antibody - BSA Free [NBP1-92436]

Staining of human skeletal muscle shows weak positivity in myocytes.

Applications for Sphingomyelin Synthase 2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sphingomyelin Synthase 2

Sphingomyelin (SM) is a major component of plasma membranes. It is preferentially concentrated in the outer leaflet and has a role in the formation of lipid rafts. SM synthases (EC 2.7.8.27), such as SGMS2, produce SM in the lumen of the Golgi and on the cell surface through the transfer of phosphocholine from phosphatidylcholine onto ceramide, yielding diacylglycerol as a side product (Huitema et al., 2004 [PubMed 14685263]).[supplied by OMIM]

Alternate Names

EC 2.7.8.27, phosphatidylcholine:ceramide cholinephosphotransferase 2, SM synthase, sphingomyelin synthase 2SMS2MGC26963

Gene Symbol

SGMS2

Additional Sphingomyelin Synthase 2 Products

Product Documents for Sphingomyelin Synthase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sphingomyelin Synthase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sphingomyelin Synthase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sphingomyelin Synthase 2 Antibody - BSA Free and earn rewards!

Have you used Sphingomyelin Synthase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...