SR-BI Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62676

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SR-BI Primary Antibodies »

Product Specifications

Immunogen

This SR-BI Antibody was developed against a recombinant protein corresponding to amino acids: CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SR-BI Antibody - BSA Free

Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676]

Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676]

Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676]

Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676]

Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676] - Analysis in human adrenal gland and pancreas tissues using Anti-SCARB1 antibody. Corresponding SCARB1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676]

Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676]

Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676] - Staining of human pancreas shows low expression as expected.

Applications for SR-BI Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SR-BI

SR-BI (scavenger receptor class B member 1, SCARB1) belongs to the CD36 family and acts as a cell surface lipoprotein receptor for a variety of ligands including high density lipoprotein (HDL), phospholipids, phosphatidylserine, and lipoproteins such as lipopolysaccharide (LPS). SR-BI mediates selective uptake of HDL cholesteryl (HDL-C) ester in the liver, steroidogenic tissues, and adipose tissue and facilitates the flux of free and esterified cholesterol between the cell surface and apoB-containing lipoproteins and modified lipoproteins. SR-BI plays a role in antigen capture and cross-presentation from bacteria, parasites, and viruses such as Hepatitis C. In endothelial cells and macrophages, SR-BI is involved in anti-inflammatory and pro-survival signaling, providing protection against atherosclerosis and clearing apoptotic cells (efferocytosis) (1, 2).

At least 5 different human splice variants have been identified with theoretical molecular weights ranging from 60.9 kDa for the canonical sequence to 45 kDa for an N-terminally truncated variant (SR-BII) (3). The extracellular domain of human SR-BI (CLA-1) shares 80%, 80%, 89%, 86% and 84% aa sequence identity with mouse, rat, porcine, rabbit, and bovine SR-BI, respectively. SR-BI is highly glycosylated and removal of N-linked glycosylation reduces lipid transport.

References

1. Linton MF, Tao H, Linton EF, Yancey PG. (2017) SR-BI: A Multifunctional Receptor in Cholesterol Homeostasis and Atherosclerosis. Trends Endocrinol Metab. 28(6):461-472. PMID: 28259375

2. Hoekstra M, Sorci-Thomas M. (2017) Rediscovering scavenger receptor type BI: surprising new roles for the HDL receptor. Curr Opin Lipidol. 28(3):255-260. PMID: 28301373

3. Shen WJ, Asthana S, Kraemer FB, Azhar S. (2018) Scavenger receptor B type 1: expression, molecular regulation, and cholesterol transport function.

Long Name

Scavenger Receptor Class B, Member I

Alternate Names

CD36L1, CLA1, HDLQTL6, SCARB1, SR-B1, SRBI

Gene Symbol

SCARB1

Additional SR-BI Products

Product Documents for SR-BI Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SR-BI Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SR-BI Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SR-BI Antibody - BSA Free and earn rewards!

Have you used SR-BI Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies