Src Antibody (7G6M9)
Novus Biologicals | Catalog # NBP3-15675
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7G6M9 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Src (P12931). MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Knockout (KO) Validated Rabbit Src Antibody (7G6M9) (NBP3-15675) is a recombinant monoclonal antibody validated for use in WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Src Antibody (7G6M9)
Immunoprecipitation: Src Antibody (7G6M9) [Src] -
Immunoprecipitation: Src Antibody (7G6M9) [Src] - Immunoprecipitation analysis of 600 ug extracts of Mouse brain using 3 ug Src antibody. Western blot was performed from the immunoprecipitate using Src antibody at a dilution of 1:1000.Western Blot: Src Antibody (7G6M9) [NBP3-15675]
Western Blot: Src Antibody (7G6M9) [NBP3-15675] - Western blot analysis of extracts of Jurkat cells, using Src antibody (NBP3-15675) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.Western Blot: Src Antibody (7G6M9) [NBP3-15675]
Western Blot: Src Antibody (7G6M9) [NBP3-15675] - Western blot analysis of extracts of various cell lines, using Src antibody (NBP3-15675) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Western Blot: Src Antibody (7G6M9) [NBP3-15675]
Western Blot: Src Antibody (7G6M9) [NBP3-15675] - Western blot analysis of extracts from normal (control) and Src knockout (KO) HeLa cells, using Src antibody (NBP3-15675) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.Immunocytochemistry/ Immunofluorescence: Src Antibody (7G6M9) [Src] -
Immunocytochemistry/ Immunofluorescence: Src Antibody (7G6M9) [Src] - Confocal imaging of NIH/3T3 cells using [KO Validated] Src Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.Immunocytochemistry/ Immunofluorescence: Src Antibody (7G6M9) [Src] -
Immunocytochemistry/ Immunofluorescence: Src Antibody (7G6M9) [Src] - Confocal imaging of A549 cells using [KO Validated] Src Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.Applications for Src Antibody (7G6M9)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:100 - 1:400
Immunoprecipitation
0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Western Blot
1:1000 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Src
Long Name
v-src Sarcoma [Schmidt-Ruppin A-2] Viral Oncogene Homolog
Alternate Names
ASV, c-Src, RSVgp4
Gene Symbol
SRC
Additional Src Products
Product Documents for Src Antibody (7G6M9)
Product Specific Notices for Src Antibody (7G6M9)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Src Antibody (7G6M9)
There are currently no reviews for this product. Be the first to review Src Antibody (7G6M9) and earn rewards!
Have you used Src Antibody (7G6M9)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
MAPK Signaling: Oxidative Stress Pathway
MAPK Signaling Pathway: Mitogen Stimulation Pathway
Pathogen or Damage-activated C-Type Lectin Receptor Signaling Pathways
VEGF - VEGF R2 Signaling Pathways
Wnt Signaling Pathways: beta-Catenin-dependent Wnt Signaling