STAM-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38514

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all STAM-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for STAM-1 Antibody - BSA Free

Western Blot: STAM-1 Antibody [NBP2-38514]

Western Blot: STAM-1 Antibody [NBP2-38514]

Western Blot: STAM-1 Antibody [NBP2-38514] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: STAM-1 Antibody [NBP2-38514]

Immunocytochemistry/ Immunofluorescence: STAM-1 Antibody [NBP2-38514]

Immunocytochemistry/Immunofluorescence: STAM-1 Antibody [NBP2-38514] - Staining of human cell line CACO-2 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514]

Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514]

Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514]

Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514]

Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514]

Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514]

Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and leydig cells.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514]

Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514]

Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Applications for STAM-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STAM-1

STAM was identified by the rapid tyrosine-phosphorylation of its product in response to cytokine stimulation. The encoded protein contains a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). This protein associates with JAK3 and JAK2 kinases via its ITAM region, and is phosphorylated by the JAK kinases upon cytokine stimulation, which suggests the function of this protein is as an adaptor molecule involved in the downstream signaling of cytokine receptors. HGS/HRS (hepatocyte grwoth factor-regulated tyrosine kinase substrate) has been found to bind and counteract the function of this protein.

Long Name

Signal Transducing Adaptor Molecule 1

Alternate Names

HSE1 Homolog, STAM, STAM1

Gene Symbol

STAM

UniProt

Q92783 (Human)

Additional STAM-1 Products

Product Documents for STAM-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for STAM-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STAM-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STAM-1 Antibody - BSA Free and earn rewards!

Have you used STAM-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies