Sterol carrier protein 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85958

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sterol carrier protein 2 Antibody - BSA Free

Western Blot: Sterol carrier protein 2 Antibody [NBP1-85958]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-85958]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-85958] - Analysis using Anti-SCP2 antibody NBP1-85958 (A) shows similar pattern to independent antibody NBP1-89514 (B).
Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958]

Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958]

Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myoctes.
Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958]

Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958]

Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958]

Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958]

Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958]

Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958]

Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Sterol carrier protein 2 Antibody - BSA Free Western Blot: Sterol carrier protein 2 Antibody - BSA Free [NBP1-85958]

Western Blot: Sterol carrier protein 2 Antibody - BSA Free [NBP1-85958]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Sterol carrier protein 2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Sterol carrier protein 2 Antibody [NBP1-85958]

Immunocytochemistry/ Immunofluorescence: Sterol carrier protein 2 Antibody [NBP1-85958]

Staining of human cell line A-431 shows localization to vesicles.

Applications for Sterol carrier protein 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sterol carrier protein 2

SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.

Alternate Names

DKFZp686C12188, DKFZp686D11188, NLTP, non-specific lipid-transfer protein, NSL-TP, Propanoyl-CoA C-acyltransferase, SCP-2, SCP-chi, SCPX, SCP-X, sterol carrier protein 2EC 2.3.1.176, Sterol carrier protein X

Gene Symbol

SCP2

Additional Sterol carrier protein 2 Products

Product Documents for Sterol carrier protein 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sterol carrier protein 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sterol carrier protein 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sterol carrier protein 2 Antibody - BSA Free and earn rewards!

Have you used Sterol carrier protein 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...