STK39 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49373

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all STK39 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQ

Reactivity Notes

Mouse (81%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for STK39 Antibody - BSA Free

Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373]

Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373]

Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373] - Staining of human liver shows low expression as expected.
Immunohistochemistry: STK39 Antibody [NBP2-49373]

Immunohistochemistry: STK39 Antibody [NBP2-49373]

Immunohistochemistry: STK39 Antibody [NBP2-49373] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in granular layer.
Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373]

Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373]

Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373]

Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373]

Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373] - Staining in human cerebral cortex and liver tissues using anti-STK39 antibody. Corresponding STK39 RNA-seq data are presented for the same tissues.

Applications for STK39 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STK39

STK39 encodes a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The catalytically active kinase specifically activates the p38 MAP kinase pathway, and its interaction with p38 decreases upon cellular stress, suggesting that this kinase may serve as an intermediate in the response to cellular stress.

Alternate Names

DCHTsmall intestine SPAK-like kinase, DKFZp686K05124, EC 2.7.11, EC 2.7.11.1, PASK, proline-alanine-rich STE20-related kinase, serine threonine kinase 39, Serine/threonine-protein kinase 39, SPAKserine threonine kinase 39 (STE20/SPS1 homolog, yeast), STE20/SPS1 homolog, STE20/SPS1-related proline-alanine-rich protein kinase, Ste20-like protein kinase, Ste-20-related kinase

Gene Symbol

STK39

Additional STK39 Products

Product Documents for STK39 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for STK39 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STK39 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STK39 Antibody - BSA Free and earn rewards!

Have you used STK39 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies