Survivin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48494

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This Survivin Antibody was developed against a recombinant protein corresponding to amino acids: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA

Reactivity Notes

Immunogen sequence has 86% homology to Mouse and 88% homology to Rat.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Survivin Antibody - BSA Free (NBP2-48494) is a polyclonal antibody validated for use in IHC and WB. Anti-Survivin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Survivin Antibody - BSA Free

Western Blot: Survivin Antibody [NBP2-48494]

Western Blot: Survivin Antibody [NBP2-48494]

Western Blot: Survivin Antibody [NBP2-48494] - Western blot using [NBP2-48494]. Analysis in control (vector only transfected HEK293T lysate) and BIRC5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells). Note: predicted molecular weight of survivin is 16 kDa.
Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494] - Immunohistochemical analysis in formalin-fixed paraffin-embedded human testis and skeletal muscle tissues using Survivin Antibody [NBP2-48494]. Corresponding BIRC5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494] - Staining of formalin-fixed paraffin-embedded human skeletal muscle using Survivin Antibody [NBP2-48494] shows no nuclear positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494] - Staining of formalin-fixed paraffin-embedded human skin using Survivin Antibody [NBP2-48494] shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494] - Staining of formalin-fixed paraffin-embedded human placenta using Survivin Antibody [NBP2-48494] shows moderate to strong nuclear and cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494]

Immunohistochemistry-Paraffin: Survivin Antibody [NBP2-48494] - Staining of formalin-fixed paraffin-embedded human testis using Survivin Antibody [NBP2-48494] shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Applications for Survivin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Survivin

Survivin (BIRC5 or IAP4) is the smallest member of the inhibitor of apoptosis (IAP) proteins, containing only a single baculovirus IAP repeat (BIR) domain and lacking the C-terminal RING domain. Survivin has a theoretical molecular weight of 16.5 kDa (wild-type protein) and exists as ten splice variant forms including the most predominant isoforms, survivin-2B and surviving-DeltaEx3 (1). It also undergoes phosphorylation by PKA, Plk1, Cdk1, CKII and Aurora B at multiple sites (e.g. Serine 20 and Threonine 34, 53 and 117).

Besides being highly abundant in fetal development and expressed in proliferating adult cells such as activated T lymphocytes, erythroblasts, and self-renewing stem cells, survivin is generally absent in adult tissues. However, it is elevated in common cancers such as lung, colon, pancreas, breast and prostate where it drives proliferation, metastasis, poor prognosis, and decreased patient survival (2).

Survivin has been shown to be involved in multiple cellular processes including cell cycle progression, mitotic spindle assembly, kinetochore attachment, angiogenesis, migration, and its anti-apoptotic activity has been linked to both its monomeric and homodimeric forms. Survivin impacts the function of other IAP members, c-IAP1 and c-IAP-2, or modulates the inhibitory activity of XIAP against caspases by forming a stable complex with XIAP and HBXIP. During the intrinsic apoptotic pathway, survivin may prevent the release of mitochondrial APAF1 into the cytoplasm or hinder the association of SMAC with other IAPS, which results in prolonged cell survival (3).

References

1. Sah NK, Seniya C. (2015) Survivin splice variants and their diagnostic significance. Tumour Biol. 36(9):6623-31. PMID: 26245993

2. Lladser A, Sanhueza C, Kiessling R, Quest AF. (2011) Is survivin the potential Achilles' heel of cancer? Adv Cancer Res. 111:1-37. PMID: 21704829

3. Wheatley SP, Altieri DC. (2019) Survivin at a glance. J Cell Sci. 132(7). PMID: 30948431

Alternate Names

API4, BIRC5

Gene Symbol

BIRC5

Additional Survivin Products

Product Documents for Survivin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Survivin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Survivin Antibody - BSA Free

Customer Reviews for Survivin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Survivin Antibody - BSA Free and earn rewards!

Have you used Survivin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Survivin Antibody - BSA Free

Showing  1 - 22 FAQs Showing All
    • A: For use in immunohistochemistry, a dilution of 1:1000-1:2500 is recommended. For use in FFPE sections, HIER pH 6 retrieval is recommended as well as a dilution of 1:1000-1:2500. Use in frozen IHC sections is not validated.
    • A: The species we have listed are validated and therefore have a 100% guarantee to work with this antibody. We cannot guarantee that this will work with other species.
Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies
Loading...

Associated Pathways

Apoptosis Signaling Pathway Apoptosis Signaling Pathway Thumbnail