Syntaxin 1A Antibody (2B2F10)

Novus Biologicals | Catalog # NBP3-15706

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2B2F10 expressed in HEK293
View all Syntaxin 1A Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 1A (Q16623). MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Syntaxin 1A Antibody (2B2F10) (NBP3-15706) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Syntaxin 1A Antibody (2B2F10)

Western Blot: Syntaxin 1A Antibody (2B2F10) [NBP3-15706]

Western Blot: Syntaxin 1A Antibody (2B2F10) [NBP3-15706]

Western Blot: Syntaxin 1A Antibody (2B2F10) [NBP3-15706] - Western blot analysis of extracts of Rat brain, using Syntaxin 1A antibody (NBP3-15706) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Western Blot: Syntaxin 1A Antibody (2B2F10) [NBP3-15706]

Western Blot: Syntaxin 1A Antibody (2B2F10) [NBP3-15706]

Western Blot: Syntaxin 1A Antibody (2B2F10) [NBP3-15706] - Western blot analysis of extracts of various cell lines, using Syntaxin 1A antibody (NBP3-15706) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: Syntaxin 1A Antibody (2B2F10) [NBP3-15706]

Immunohistochemistry-Paraffin: Syntaxin 1A Antibody (2B2F10) [NBP3-15706]

Immunohistochemistry-Paraffin: Syntaxin 1A Antibody (2B2F10) [NBP3-15706] - Immunohistochemistry of paraffin-embedded mouse brain using Syntaxin 1A Rabbit mAb (NBP3-15706) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Syntaxin 1A Antibody (2B2F10)

Immunocytochemistry/ Immunofluorescence: Syntaxin 1A Antibody (2B2F10) [Syntaxin 1A] -

Immunocytochemistry/ Immunofluorescence: Syntaxin 1A Antibody (2B2F10) [Syntaxin 1A] - Immunofluorescence analysis of paraffin-embedded rat brain using Syntaxin 1A Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Syntaxin 1A Antibody (2B2F10)

Immunocytochemistry/ Immunofluorescence: Syntaxin 1A Antibody (2B2F10) [Syntaxin 1A] -

Immunocytochemistry/ Immunofluorescence: Syntaxin 1A Antibody (2B2F10) [Syntaxin 1A] - Immunofluorescence analysis of paraffin-embedded mouse brain using Syntaxin 1A Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Syntaxin 1A Antibody (2B2F10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Simple Western

1:20 - 1:250

Western Blot

1:500 - 1:1000
Application Notes

See Simple Western Antibody Database for Simple Western validation: Tested in Mouse brain lysate, separated by Size, antibody dilution of 1;20, 1:100, 1:250, apparent MW was 42 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Syntaxin 1A

Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM]

Alternate Names

Brain Syntaxin, HPC-1, p35-1, STX1A, SYN1A

Gene Symbol

STX1A

Additional Syntaxin 1A Products

Product Documents for Syntaxin 1A Antibody (2B2F10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Syntaxin 1A Antibody (2B2F10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Syntaxin 1A Antibody (2B2F10)

There are currently no reviews for this product. Be the first to review Syntaxin 1A Antibody (2B2F10) and earn rewards!

Have you used Syntaxin 1A Antibody (2B2F10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies