Tafazzin/TAZ Antibody (1B10) - Azide and BSA Free
Novus Biologicals | Catalog # H00006901-M12
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 1B10
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
TAZ (AAH11515, 1 a.a. ~ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 28515468).
Specificity
TAZ (1B10)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for Tafazzin/TAZ Antibody (1B10) - Azide and BSA Free
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12]
Tafazzin-TAZ-Antibody-1B10-Western-Blot-H00006901-M12-img0010.jpgWestern Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12]
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in PC-12 (Cat # L012V1).Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12]
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in SW-13 (Cat # L005V1).Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12]
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in human uterus myoma.Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12]
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in human kidney.ELISA: Tafazzin/TAZ Antibody (1B10) [H00006901-M12]
ELISA: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Detection limit for recombinant GST tagged TAZ is approximately 3ng/ml as a capture antibody.Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] -
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Taz protein expression is higher in the soleus compared with plantaris & is upregulated in response to both overload (OVL) & unload (UNL) stimuli. (a) Taz protein expression (~27 kDa) in the sham plantaris & soleus muscles. (b) Taz protein in the OVL plantaris compared with sham. (c) Taz protein in the UNL soleus compared with sham. *p ≤ 0.05 using a Student’s t-test (a, two-tailed) or paired t-test (b & c, two-tailed), n = 6 per group. Please refer to Fig. S4 for full length Western blots. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28515468), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Tafazzin/TAZ Antibody (1B10) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for ELISA.
Reviewed Applications
Read 1 review rated 3 using H00006901-M12 in the following applications:
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: Tafazzin/TAZ
Alternate Names
BTHSEFE, cardiomyopathy, dilated 3A (X-linked), CMD3A, EFE2FLJ27390, G4.5endocardial fibroelastosis 2, LVNCX, Protein G4.5, tafazzin, Taz1, XAP-2
Gene Symbol
TAFAZZIN
OMIM
300069 (Human)
UniProt
Additional Tafazzin/TAZ Products
Product Documents for Tafazzin/TAZ Antibody (1B10) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Tafazzin/TAZ Antibody (1B10) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Tafazzin/TAZ Antibody (1B10) - Azide and BSA Free
Customer Reviews for Tafazzin/TAZ Antibody (1B10) - Azide and BSA Free (1)
3 out of 5
1 Customer Rating
Have you used Tafazzin/TAZ Antibody (1B10) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: SoleusSpecies: MouseVerified Customer | Posted 08/26/2016Tafazzin expression in mouse soleus
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...