TCF-3/E2A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38611

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TCF-3/E2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TCF-3/E2A Antibody [NBP2-38611]

Immunocytochemistry/ Immunofluorescence: TCF-3/E2A Antibody [NBP2-38611]

Immunocytochemistry/Immunofluorescence: TCF-3/E2A Antibody [NBP2-38611] - Staining of human cell line MCF7 shows localization to nuclear speckles. Antibody staning is shown in green.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611]

Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611]

Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611]

Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611]

Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611]

Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611]

Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human lymphoid tissues shows weak to moderate nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611]

Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611]

Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human gastrointestinal shows weak to moderate nuclear positivity in lymphoid cells.
TCF-3/E2A Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TCF-3/E2A Antibody - BSA Free [NBP2-38611]

Chromatin Immunoprecipitation-exo-Seq: TCF-3/E2A Antibody - BSA Free [NBP2-38611]

ChIP-Exo-Seq composite graph for Anti-TCF3 (NBP2-38611) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TCF-3/E2A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TCF-3/E2A

TCF3 / E2A encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporatic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Long Name

Transcription Factor 3/E2-alpha

Alternate Names

bHLHb21, E2A, ITF1, Kappa-E2-binding factor, Pan2, Tcfe2a, VDIR

Gene Symbol

TCF3

UniProt

Additional TCF-3/E2A Products

Product Documents for TCF-3/E2A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TCF-3/E2A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TCF-3/E2A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TCF-3/E2A Antibody - BSA Free and earn rewards!

Have you used TCF-3/E2A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies