Tight Junction Protein 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86850

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Biological Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28420508) and a verfied customer review.

Marker

Intercellular Junctions Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Tight Junction Protein 2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Green: CD31 Red: Tight Junction Protein 2 Blue: Nuclei. Lung frozen section was blocked and stained with TJP-2 at 1:100 dilution for a hour. A secondary Alexa 555-conjugated goat anti-rabbit antibody was used for labeling. Section was aso co-stained with CD31 antibody in conjunction with an Alexa 488-conjugated antibody. Nuclei was revealed by DAPU staining. Image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm and cell junctions. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining in primary mouse lung endothelial cells. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human pancreas shows weak cytoplasmic psotivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human cerebral cortex shows strong cytoplasmic psotivity in glial cells.
Tight Junction Protein 2 Antibody - BSA Free Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody - BSA Free [NBP1-86850]

Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody - BSA Free [NBP1-86850]

Staining of human testis shows strong membranous and cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: Tight Junction Protein 2 Antibody [NBP1-86850]

Western Blot: Tight Junction Protein 2 Antibody [NBP1-86850]

Western Blot: Tight Junction Protein 2 Antibody [NBP1-86850] - Primary mouse lung endothelial cells treated with or without control IgG was blotted with the anti-TJP-2 antibody. Primary Antibody diluted 1:1000. Image submitted by a verified customer review.
Immunoprecipitation: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunoprecipitation: Tight Junction Protein 2 Antibody [NBP1-86850]

Immunoprecipitation: Tight Junction Protein 2 Antibody [NBP1-86850] - HEK293 cells were lysed and immunoprecipitated wtih anti-TJP2 ab (NBP1-86850) and Protein A/G PLUS-Agarose. The precipitates were separated by SDS-PAGE and blotted with anti-ZO1 antibody. IP image submitted by a verified customer review.
Tight Junction Protein 2 Antibody - BSA Free Western Blot: Tight Junction Protein 2 Antibody - BSA Free [NBP1-86850]

Western Blot: Tight Junction Protein 2 Antibody - BSA Free [NBP1-86850]

Analysis in human cell lines A-431 and SK-MEL-30 using Anti-TJP2 antibody. Corresponding TJP2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Applications for Tight Junction Protein 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

Validated from a verified customer review

Western Blot

0.04 - 0.4 ug/mL
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 5 reviews rated 4.6 using NBP1-86850 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tight Junction Protein 2

TJP2 - tight junction protein 2 (zona occludens 2). embers of this family are involved in epithelial and endothelial intercellular junctions. They each contain at least one PSD95/Dlg/ZO-1 (PDZ) domain, a Src homology 3 (SH3) domain, and an enzymatically inactive guanylate kinase domain. PDZ domains are 90-amino acid protein-protein binding domains that recognize at least a 3-residue peptide motif in the COOH termini of their binding partners. PDZ domain-containing proteins, like ZO-2, typically act as scaffolding proteins that organize membrane receptors and cytosolic proteins into multimeric signaling complexes often at the sites of cell-cell contact. The effectiveness and stability of the epithelial barrier depends on a complex of proteins composing different intercellular junctions, which include tight junctions, adherens junctions, and desmosomes. ZO-2 can interact with zona occludens 1 (ZO-1). Furthermore, the PDZ2 domain of ZO-2 was shown to interact with connexin-43, the predominant connexin in epithelial and most other tissues which is involved in cell growth control and embryonic development.

Alternate Names

C9DUPq21.11, DFNA51, DUP9q21.11, MGC26306, Tight junction protein 2, tight junction protein 2 (zona occludens 2), TJP2, X104, X104tight junction protein ZO-2, ZO2, ZO-2, ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2), Zona occludens protein 2, Zonula occludens protein 2

Gene Symbol

TJP2

Additional Tight Junction Protein 2 Products

Product Documents for Tight Junction Protein 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tight Junction Protein 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Tight Junction Protein 2 Antibody - BSA Free

Customer Reviews for Tight Junction Protein 2 Antibody - BSA Free (5)

4.6 out of 5
5 Customer Ratings
5 Stars
80%
4 Stars
0%
3 Stars
20%
2 Stars
0%
1 Stars
0%

Have you used Tight Junction Protein 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 55 reviews Showing All
Filter By:
  • Tight Junction Protein 2 Antibody
    Name: Akihiro Asai
    Application: Immunoprecipitation
    Sample Tested: 293 whole cell lysate
    Species: Human
    Verified Customer | Posted 06/18/2021
    Western blotting result with immunoprecipitation experiments. HEK293 cells were lysed and immunoprecipitated wtih anti-TJP2 ab (NBP1-86850) and Protein A/G PLUS-Agarose. The precipitates underwent SDS-PAGE and blotted with anti-ZO1 antibody.
    Tight Junction Protein 2 Antibody - BSA Free NBP1-86850
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • Tight Junction Protein 2 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: human skin
    Species: Human
    Verified Customer | Posted 04/11/2019
    Tight Junction Protein 2 Antibody - BSA Free NBP1-86850
  • Tight Junction Protein 2 Antibody
    Name: James Xiao
    Application: Immunocytochemistry
    Sample Tested: Frozen Tissue and Mouse lung frozen section
    Species: Mouse
    Verified Customer | Posted 05/17/2017
    Green: CD31 Red: Tight Junction Protein 2 Blue: Nuclei
    Lung frozen section was blocked and stained with TJP-2 @ 1:100 dilution for a hour. A secondary Alexa 555-conjugated goat anti-rabbit antibody was used for labeling. Section was aso co-stained with CD31 antibody in conjunction with an Alexa 488-conjugated antibody. Nuclei was revealed by DAPU staining.
    Tight Junction Protein 2 Antibody - BSA Free NBP1-86850
  • Tight Junction Protein 2 Antibody
    Name: James Xiao
    Application: Western Blot
    Sample Tested: Primary mouse lung endothelial cells
    Species: Mouse
    Verified Customer | Posted 05/11/2017
    Primary mouse lung endothelial cells treated with or without control IgG was blotted with the anti-TJP-2 antibody.
    The antibody was diluted in PBST contained 5% milk at 1:1000. The secondary antibody was diluted at 1:5000.
    Tight Junction Protein 2 Antibody - BSA Free NBP1-86850
  • Tight Junction Protein 2 Antibody
    Name: James Xiao
    Application: Immunocytochemistry/Immunofluorescence
    Sample Tested: Primary mouse lung endothelial cells
    Species: Primary mouse lung endothelial cells and Mouse
    Verified Customer | Posted 10/13/2016
    The primary mouse lung endothelial cell was fixed, permeabilized and stained with 1:50 diluted anti-ZO-2 ab (NBP1-86850) for overnight. Cell was washed and was then incubated with Alexa flur546 dye for 1-hour in room temperature.
    Tight Junction Protein 2 Antibody - BSA Free NBP1-86850

There are no reviews that match your criteria.

Showing  1 - 55 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...