TIMM23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93133

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 7-72 of human TIMM23 (NP_006318.1). SGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TIMM23 Antibody - BSA Free

TIMM23 Antibody - Azide and BSA Free

Western Blot: TIMM23 Antibody - Azide and BSA Free [NBP2-93133] -

Western Blot: TIMM23 Antibody - Azide and BSA Free [NBP2-93133] - Western blot analysis of various lysates using TIMM23 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
TIMM23 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TIMM23 Antibody - Azide and BSA Free [NBP2-93133] -

Immunocytochemistry/ Immunofluorescence: TIMM23 Antibody - Azide and BSA Free [NBP2-93133] - Immunofluorescence analysis of NIH/3T3 cells using TIMM23 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
TIMM23 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TIMM23 Antibody - Azide and BSA Free [NBP2-93133] -

Immunocytochemistry/ Immunofluorescence: TIMM23 Antibody - Azide and BSA Free [NBP2-93133] - Immunofluorescence analysis of A549 cells using TIMM23 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
TIMM23 Antibody - BSA Free

TIMM23 Antibody - Azide and BSA Free [NBP2-93133] -

Analysis of paraffin-embedded Human kidney tissue using TIMM23 Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for TIMM23 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 -1:200

Immunohistochemistry

1:400 - 1:1600

Immunohistochemistry-Paraffin

1:400 - 1:1600

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TIMM23

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane

Alternate Names

bA592B15.7, MGC22767, PRO1197, RP11-592B15.7, TIM23

Gene Symbol

TIMM23

Additional TIMM23 Products

Product Documents for TIMM23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIMM23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for TIMM23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIMM23 Antibody - BSA Free and earn rewards!

Have you used TIMM23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...