TOMM34 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38810

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TOMM34 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TOMM34 Antibody - BSA Free

Western Blot: TOMM34 Antibody [NBP2-38810]

Western Blot: TOMM34 Antibody [NBP2-38810]

Western Blot: TOMM34 Antibody [NBP2-38810] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: TOMM34 Antibody [NBP2-38810]

Immunocytochemistry/ Immunofluorescence: TOMM34 Antibody [NBP2-38810]

Immunocytochemistry/Immunofluorescence: TOMM34 Antibody [NBP2-38810] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
Immunohistochemistry-Paraffin: TOMM34 Antibody [NBP2-38810]

Immunohistochemistry-Paraffin: TOMM34 Antibody [NBP2-38810]

Immunohistochemistry-Paraffin: TOMM34 Antibody [NBP2-38810] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry: TOMM34 Antibody [NBP2-38810]

Immunohistochemistry: TOMM34 Antibody [NBP2-38810]

Immunohistochemistry: TOMM34 Antibody [NBP2-38810] - Staining of human testis shows strong cytoplasmic positivity in basal cells of seminiferous ducts.
Immunohistochemistry-Paraffin: TOMM34 Antibody [NBP2-38810]

Immunohistochemistry-Paraffin: TOMM34 Antibody [NBP2-38810]

Immunohistochemistry-Paraffin: TOMM34 Antibody [NBP2-38810] - Staining in human testis and endometrium tissues using anti-TOMM34 antibody. Corresponding TOMM34 RNA-seq data are presented for the same tissues.

Applications for TOMM34 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TOMM34

TOMM34 is encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats.

Alternate Names

hTom34, HTOM34P, mitochondrial import receptor subunit TOM34, outer mitochondrial membrane translocase (34kD), TOM34, Translocase of outer membrane 34 kDa subunit, translocase of outer mitochondrial membrane 34, URCC3

Gene Symbol

TOMM34

UniProt

Q15785 (Human)

Additional TOMM34 Products

Product Documents for TOMM34 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TOMM34 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TOMM34 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TOMM34 Antibody - BSA Free and earn rewards!

Have you used TOMM34 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies