Topoisomerase I Antibody (1A1) - Azide and BSA Free

Novus Biologicals | Catalog # H00007150-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1A1

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF

Localization

Cytoplasmic and Nuclear.

Specificity

TOP1 - topoisomerase (DNA) I

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Topoisomerase I Antibody (1A1) - Azide and BSA Free

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01]

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01]

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in JAR.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01] - Analysis of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1~10 ug/ml.
Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01]

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01]

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in HeLa.
Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01]

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01]

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in human ovarian cancer.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01] - Analysis of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. Antibody concentration 3 ug/ml.
ELISA: Topoisomerase I Antibody (1A1) [H00007150-M01]

ELISA: Topoisomerase I Antibody (1A1) [H00007150-M01]

ELISA: Topoisomerase I Antibody (1A1) [H00007150-M01] - Detection limit for recombinant GST tagged TOP1 is approximately 0.3ng/ml as a capture antibody.

Applications for Topoisomerase I Antibody (1A1) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Topoisomerase I

Topoisomerases are nuclear enzymes involved in a variety of cellular activities such as chromosome condensation, DNA replication, transcription, recombination and segregation at mitosis. Human topoisomerase I is a 100kD protein capable of relaxing positively and negatively supercoiled DNA by performing a transient single stranded nick which is then religated at the end of the reaction. It has been shown that the enzyme is located in regions of the genome that are undergoing active RNA synthesis, where it probably reduces superhelical stresses in the DNA, enabling RNA polymerase to function properly. Both DNA topoisomerases I and II have been found to be targets of autoantibodies in the sera of patients with certain autoimmune diseases such as systemic lupus erythematosus and also of some anti tumor drugs and antibiotics. Elevated levels of DNA topoisomerase I, detected by transfer assays, have been demonstrated in colorectal tumors compared with normal colon mucosa as a result of increased transcription or mRNA stability.

Long Name

DNA topoisomerase 1

Alternate Names

DNA topoisomerase I, EC 5.6.2.1, TOP1

Entrez Gene IDs

7150 (Human)

Gene Symbol

TOP1

OMIM

126420 (Human)

Additional Topoisomerase I Products

Product Documents for Topoisomerase I Antibody (1A1) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Topoisomerase I Antibody (1A1) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Topoisomerase I Antibody (1A1) - Azide and BSA Free

Customer Reviews for Topoisomerase I Antibody (1A1) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Topoisomerase I Antibody (1A1) - Azide and BSA Free and earn rewards!

Have you used Topoisomerase I Antibody (1A1) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...