TRAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47598

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRAP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIREL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRAP1 Antibody - BSA Free

Western Blot: TRAP1 Antibody [NBP2-47598]

Western Blot: TRAP1 Antibody [NBP2-47598]

Western Blot: TRAP1 Antibody [NBP2-47598] - Analysis using Anti-TRAP1 antibody NBP2-47598 (A) shows similar pattern to independent antibody NBP2-47597 (B).
Immunocytochemistry/ Immunofluorescence: TRAP1 Antibody [NBP2-47598]

Immunocytochemistry/ Immunofluorescence: TRAP1 Antibody [NBP2-47598]

Immunocytochemistry/Immunofluorescence: TRAP1 Antibody [NBP2-47598] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598] - Staining of human fallopian tube shows strong to very strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry: TRAP1 Antibody [NBP2-47598] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules. Moderate staining was observed in cells in glomeruli.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598] - Staining of human cerebellum, fallopian tube, kidney and testis using Anti-TRAP1 antibody NBP2-47598 (A) shows similar protein distribution across tissues to independent antibody NBP2-47597 (B).
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598] - Staining of human cerebellum shows moderate to strong granular cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47598] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in seminiferous ducts.

Applications for TRAP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRAP1

The 90 kDa heat shock protein (hsp90) family of molecular chaperones is a highly conserved family of proteins that play an important physiological role. Hsp90 is involved in numerous cellular processes but is best known for its association with signal transduction machinery. A recently cloned homolog of hsp90 is TRAP1. Like hsp90, TRAP1 is found to be associated with numerous proteins involved in diverse actions. Immunofluorescence data has shown TRAP1 to be localized in the mitochondria of mammalian cells. This observation and the fact that TRAP1 is shown to have a mitochondrial targeting presequence strongly implicates TRAP1 as a mitochondrial matrix protein. Immunofluorescence staining of TRAP1 in PC-3-M cells with this antibody produces a pattern consistent with mitochondrial staining. Immunoprecipitation of TRAP1 using this antibody fails to co-precipitate p23, Hop, or CyP40 suggesting TRAP1®s inability to associate with these co-chaperones.

Alternate Names

HSP 75, HSP75TNFR-associated protein 1, HSP90Lheat shock protein 75 kDa, mitochondrial, TNF receptor-associated protein 1, TRAP-1, tumor necrosis factor type 1 receptor associated protein, Tumor necrosis factor type 1 receptor-associated protein

Gene Symbol

TRAP1

Additional TRAP1 Products

Product Documents for TRAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRAP1 Antibody - BSA Free and earn rewards!

Have you used TRAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies