Troponin T Type 3 (fast skeletal) Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92534

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534]

Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534]

Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Staining in human skeletal muscle and heart muscle tissues using anti-TNNT3 antibody. Corresponding TNNT3 RNA-seq data are presented for the same tissues.
Western Blot: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534]

Western Blot: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534]

Western Blot: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534]

Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534]

Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Staining of human heart muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534]

Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534]

Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Staining of human skeletal muscle shows high expression.
Troponin T Type 3 (fast skeletal) Antibody - BSA Free Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Troponin T Type 3 (fast skeletal) Antibody - BSA Free Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Staining of human liver shows no positivity in hepatocytes as expected.
Troponin T Type 3 (fast skeletal) Antibody - BSA Free Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Staining of human heart muscle shows no cytoplasmic positivity in cardiomyocytes as expected.
Troponin T Type 3 (fast skeletal) Antibody - BSA Free Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Staining of human small intestine shows no positivity in glandular cells as expected.
Troponin T Type 3 (fast skeletal) Antibody - BSA Free Western Blot: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Western Blot: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Analysis in human cell line RT-4.
Troponin T Type 3 (fast skeletal) Antibody - BSA Free Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Immunohistochemistry: Troponin T Type 3 (fast skeletal) Antibody - BSA Free [NBP1-92534]

Analysis in human skeletal muscle and heart muscle tissues using NBP1-92534 antibody. Corresponding TNNT3 RNA-seq data are presented for the same tissues.

Applications for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Troponin T Type 3 (fast skeletal)

Cardiac Troponin T, a 36kDa protein, is the tropomyosin binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations within the protein have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for the gene undergo alternative splicing that results in many tissue specific isoforms.

Alternate Names

Beta-TnTF, fast skeletal muscle, TnTf, troponin T type 3 (skeletal, fast), troponin T3, skeletal, fast, troponin-T3, skeletal, fast

Gene Symbol

TNNT3

Additional Troponin T Type 3 (fast skeletal) Products

Product Documents for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Troponin T Type 3 (fast skeletal) Antibody - BSA Free and earn rewards!

Have you used Troponin T Type 3 (fast skeletal) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...