TRPA1 Antibody (6G8) - Azide and BSA Free
Novus Biologicals | Catalog # H00008989-M03
![Western Blot: TRPA1 Antibody (6G8) [H00008989-M03]](https://beta-resources.rndsystems.com/images/products/TRPA1-Antibody-6G8-Western-Blot-H00008989-M03-img0004.jpg "Western Blot: TRPA1 Antibody (6G8) [H00008989-M03]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Guinea Pig
Cited:
Guinea Pig
Applications
Validated:
Immunohistochemistry, Western Blot, ELISA
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 6G8
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
TRPA1 (NP_015628, 1033 a.a. ~ 1117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
Reactivity Notes
Guinea Pig reactivity reported from customer review.
Specificity
TRPA1 - transient receptor potential cation channel, subfamily A, member 1
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for TRPA1 Antibody (6G8) - Azide and BSA Free
Western Blot: TRPA1 Antibody (6G8) [H00008989-M03]
Western Blot: TRPA1 Antibody (6G8) [H00008989-M03] - Analysis of TRPA1 expression in transfected 293T cell line by TRPA1 monoclonal antibody (M03), clone 6G8. Lane 1: TRPA1 transfected lysate (Predicted MW: 123.09 KDa). Lane 2: Non-transfected lysate.![Western Blot: TRPA1 Antibody (6G8) [H00008989-M03]](https://beta-resources.rndsystems.com/images/products/TRPA1-Antibody-6G8-Western-Blot-H00008989-M03-img0001.jpg "Western Blot: TRPA1 Antibody (6G8) [H00008989-M03]")
Western Blot: TRPA1 Antibody (6G8) [H00008989-M03]
Western Blot: TRPA1 Antibody (6G8) [H00008989-M03] - WB analysis of TRPA1 using anti-TRPA1 antibody on guinea pig nerve ganglia samples. Image from verified customer review.![ELISA: TRPA1 Antibody (6G8) [H00008989-M03]](https://beta-resources.rndsystems.com/images/products/TRPA1-Antibody-6G8-Sandwich-ELISA-H00008989-M03-img0003.jpg "ELISA: TRPA1 Antibody (6G8) [H00008989-M03]")
ELISA: TRPA1 Antibody (6G8) [H00008989-M03]
ELISA: TRPA1 Antibody (6G8) [H00008989-M03] - Detection limit for recombinant GST tagged TRPA1 is 1 ng/ml as a capture antibody.Applications for TRPA1 Antibody (6G8) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 review rated 5 using H00008989-M03 in the following applications:
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: TRPA1
Long Name
Transient receptor potential cation channel subfamily A member 1
Alternate Names
ANKTM1, Wasabi receptor
Entrez Gene IDs
8989 (Human)
Gene Symbol
TRPA1
OMIM
604775 (Human)
UniProt
Additional TRPA1 Products
Product Documents for TRPA1 Antibody (6G8) - Azide and BSA Free
Product Specific Notices for TRPA1 Antibody (6G8) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TRPA1 Antibody (6G8) - Azide and BSA Free
Powered by Bioz
Customer Reviews for TRPA1 Antibody (6G8) - Azide and BSA Free (1)
5 out of 5
1 Customer Rating
Have you used TRPA1 Antibody (6G8) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: guinea pig nerve gangliaSpecies: Guinea PigVerified Customer | Posted 09/26/2014TRPA1 antibody WB on DRG, Jugular and Nodose ganglia from guinea pig
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...