Tryptophanyl tRNA synthetase Antibody (1C6K8)

Novus Biologicals | Catalog # NBP3-33363

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1C6K8
View all Tryptophanyl tRNA synthetase Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl tRNA synthetase (P23381).

Sequence:
VNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Tryptophanyl tRNA synthetase Antibody (1C6K8)

Tryptophanyl tRNA synthetase Antibody (1C6K8)

Western Blot: Tryptophanyl tRNA synthetase Antibody (1C6K8) [NBP3-33363] -

Western Blot: Tryptophanyl tRNA synthetase Antibody (1C6K8) [NBP3-33363] - Western blot analysis of lysates from U-937 cells using Tryptophanyl tRNA synthetase Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Tryptophanyl tRNA synthetase Antibody (1C6K8)

Western Blot: Tryptophanyl tRNA synthetase Antibody (1C6K8) [NBP3-33363] -

Western Blot: Tryptophanyl tRNA synthetase Antibody (1C6K8) [NBP3-33363] - Western blot analysis of lysates from U-937 cells using Tryptophanyl tRNA synthetase Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for Tryptophanyl tRNA synthetase Antibody (1C6K8)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunohistochemistry-Paraffin

1:50 - 1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Tryptophanyl tRNA synthetase

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.

Alternate Names

EC 6.1.1, EC 6.1.1.2, GAMMA-2, hWRS, IFI53, IFP53trpRS, Interferon-induced protein 53, TrpRS, tryptophan tRNA ligase 1, cytoplasmic, Tryptophan--tRNA ligase, tryptophanyl-tRNA synthetase, tryptophanyl-tRNA synthetase, cytoplasmic, WRS

Gene Symbol

WARS1

Additional Tryptophanyl tRNA synthetase Products

Product Documents for Tryptophanyl tRNA synthetase Antibody (1C6K8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tryptophanyl tRNA synthetase Antibody (1C6K8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tryptophanyl tRNA synthetase Antibody (1C6K8)

There are currently no reviews for this product. Be the first to review Tryptophanyl tRNA synthetase Antibody (1C6K8) and earn rewards!

Have you used Tryptophanyl tRNA synthetase Antibody (1C6K8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies