U2AF2 Antibody (8E8R9)

Novus Biologicals | Catalog # NBP3-16432

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8E8R9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 376-475 of human U2AF2 (P26368). EVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for U2AF2 Antibody (8E8R9)

Western Blot: U2AF2 Antibody (8E8R9) [NBP3-16432]

Western Blot: U2AF2 Antibody (8E8R9) [NBP3-16432]

Western Blot: U2AF2 Antibody (8E8R9) [NBP3-16432] - Western blot analysis of extracts of various cell lines, using U2AF2/U2AF2 Rabbit mAb (NBP3-16432) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: U2AF2 Antibody (8E8R9) [NBP3-16432]

Western Blot: U2AF2 Antibody (8E8R9) [NBP3-16432]

Western Blot: U2AF2 Antibody (8E8R9) [NBP3-16432] - Western blot analysis of extracts of various cell lines, using U2AF2/U2AF2 Rabbit mAb (NBP3-16432) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunoprecipitation: U2AF2 Antibody (8E8R9) [NBP3-16432]

Immunoprecipitation: U2AF2 Antibody (8E8R9) [NBP3-16432]

Immunoprecipitation: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug U2AF2 antibody (NBP3-16432). Western blot was performed from the immunoprecipitate using U2AF2 antibody (NBP3-16432) at a dilition of 1:1000.
Immunohistochemistry-Paraffin: U2AF2 Antibody (8E8R9) [NBP3-16432]

Immunohistochemistry-Paraffin: U2AF2 Antibody (8E8R9) [NBP3-16432]

Immunohistochemistry-Paraffin: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry of paraffin-embedded human colon using U2AF2/U2AF2 Rabbit mAb (NBP3-16432) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
U2AF2 Antibody (8E8R9)

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] -

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
U2AF2 Antibody (8E8R9)

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] -

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
U2AF2 Antibody (8E8R9)

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] -

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
U2AF2 Antibody (8E8R9)

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] -

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
U2AF2 Antibody (8E8R9)

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] -

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
U2AF2 Antibody (8E8R9)

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] -

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
U2AF2 Antibody (8E8R9)

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] -

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
U2AF2 Antibody (8E8R9)

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] -

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
U2AF2 Antibody (8E8R9)

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] -

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for U2AF2 Antibody (8E8R9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunohistochemistry

1:500 - 1:2000

Immunohistochemistry-Paraffin

1:500 - 1:2000

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:1000-1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: U2AF2

U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date. [provided by RefSeq]

Alternate Names

hU2AF(65), hU2AF65, splicing factor U2AF 65 kD subunit, splicing factor U2AF 65 kDa subunit, U2 (RNU2) small nuclear RNA auxiliary factor 2, U2 auxiliary factor 65 kDa subunit, U2 small nuclear ribonucleoprotein auxiliary factor (65kD), U2 small nuclear RNA auxiliary factor 2, U2AF65U2 snRNP auxiliary factor large subunit

Gene Symbol

U2AF2

Additional U2AF2 Products

Product Documents for U2AF2 Antibody (8E8R9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for U2AF2 Antibody (8E8R9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for U2AF2 Antibody (8E8R9)

There are currently no reviews for this product. Be the first to review U2AF2 Antibody (8E8R9) and earn rewards!

Have you used U2AF2 Antibody (8E8R9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...